Anti CFAP52 pAb (ATL-HPA030635)

Atlas Antibodies

Catalog No.:
ATL-HPA030635-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cilia and flagella associated protein 52
Gene Name: CFAP52
Alternative Gene Name: FLJ37528, WDR16, WDRPUH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020904: 93%, ENSRNOG00000037718: 93%
Entrez Gene ID: 146845
Uniprot ID: Q8N1V2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTDFKETLIATCHFDAVKDIVFPFGTAELFATCAKKDIRVWHTSSNRELLRITVPNMTCHGIDFMRDGKSIISAWNDGKIRAFAPETGRLMYVIN
Gene Sequence FTDFKETLIATCHFDAVKDIVFPFGTAELFATCAKKDIRVWHTSSNRELLRITVPNMTCHGIDFMRDGKSIISAWNDGKIRAFAPETGRLMYVIN
Gene ID - Mouse ENSMUSG00000020904
Gene ID - Rat ENSRNOG00000037718
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CFAP52 pAb (ATL-HPA030635)
Datasheet Anti CFAP52 pAb (ATL-HPA030635) Datasheet (External Link)
Vendor Page Anti CFAP52 pAb (ATL-HPA030635) at Atlas Antibodies

Documents & Links for Anti CFAP52 pAb (ATL-HPA030635)
Datasheet Anti CFAP52 pAb (ATL-HPA030635) Datasheet (External Link)
Vendor Page Anti CFAP52 pAb (ATL-HPA030635)