Anti CFAP52 pAb (ATL-HPA030635)

Atlas Antibodies

SKU: ATL-HPA030635-25

• 

Protein Description: cilia and flagella associated protein 52
Gene Name: CFAP52
Alternative Gene Name: FLJ37528, WDR16, WDRPUH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020904: 93%, ENSRNOG00000037718: 93%
Entrez Gene ID: 146845
Uniprot ID: Q8N1V2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FTDFKETLIATCHFDAVKDIVFPFGTAELFATCAKKDIRVWHTSSNRELLRITVPNMTCHGIDFMRDGKSIISAWNDGKIRAFAPETGRLMYVIN
• Gene Sequence: FTDFKETLIATCHFDAVKDIVFPFGTAELFATCAKKDIRVWHTSSNRELLRITVPNMTCHGIDFMRDGKSIISAWNDGKIRAFAPETGRLMYVIN
• Gene ID - Mouse: ENSMUSG00000020904
• Gene ID - Rat: ENSRNOG00000037718
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.