Anti CFAP47 pAb (ATL-HPA054859)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054859-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CFAP47
Alternative Gene Name: CHDC2, CXorf22, CXorf30, CXorf59, FLJ36601, MGC34831, RP13-11B7.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073077: 54%, ENSRNOG00000008990: 26%
Entrez Gene ID: 286464
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | APPPKSPPVVIQCQSRKRAEEKVEIILNAGFFGFSLTPDLTEVLVIPKRNSHNFCEDPNEIPKIHEFEYEIQFESEAMKSKLESCVALY |
Gene Sequence | APPPKSPPVVIQCQSRKRAEEKVEIILNAGFFGFSLTPDLTEVLVIPKRNSHNFCEDPNEIPKIHEFEYEIQFESEAMKSKLESCVALY |
Gene ID - Mouse | ENSMUSG00000073077 |
Gene ID - Rat | ENSRNOG00000008990 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CFAP47 pAb (ATL-HPA054859) | |
Datasheet | Anti CFAP47 pAb (ATL-HPA054859) Datasheet (External Link) |
Vendor Page | Anti CFAP47 pAb (ATL-HPA054859) at Atlas Antibodies |
Documents & Links for Anti CFAP47 pAb (ATL-HPA054859) | |
Datasheet | Anti CFAP47 pAb (ATL-HPA054859) Datasheet (External Link) |
Vendor Page | Anti CFAP47 pAb (ATL-HPA054859) |