Anti CFAP46 pAb (ATL-HPA038868)

Atlas Antibodies

Catalog No.:
ATL-HPA038868-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cilia and flagella associated protein 46
Gene Name: CFAP46
Alternative Gene Name: bA288G11.4, bA288G11.5, bB137A17.2, bB137A17.3, C10orf123, C10orf124, C10orf92, C10orf93, DKFZp434A1721, FLJ25954, TTC40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049571: 63%, ENSRNOG00000030314: 29%
Entrez Gene ID: 54777
Uniprot ID: Q8IYW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKALQKMCLHELTVPVLQLGVLISDSVVGSKGLSDLYHLRLAHACSELKLREAAARHEEAVGQVCVSELEQASCR
Gene Sequence VKALQKMCLHELTVPVLQLGVLISDSVVGSKGLSDLYHLRLAHACSELKLREAAARHEEAVGQVCVSELEQASCR
Gene ID - Mouse ENSMUSG00000049571
Gene ID - Rat ENSRNOG00000030314
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CFAP46 pAb (ATL-HPA038868)
Datasheet Anti CFAP46 pAb (ATL-HPA038868) Datasheet (External Link)
Vendor Page Anti CFAP46 pAb (ATL-HPA038868) at Atlas Antibodies

Documents & Links for Anti CFAP46 pAb (ATL-HPA038868)
Datasheet Anti CFAP46 pAb (ATL-HPA038868) Datasheet (External Link)
Vendor Page Anti CFAP46 pAb (ATL-HPA038868)