Anti CFAP46 pAb (ATL-HPA038867)

Atlas Antibodies

SKU: ATL-HPA038867-25

• 

Protein Description: cilia and flagella associated protein 46
Gene Name: CFAP46
Alternative Gene Name: bA288G11.4, bA288G11.5, bB137A17.2, bB137A17.3, C10orf123, C10orf124, C10orf92, C10orf93, DKFZp434A1721, FLJ25954, TTC40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049571: 59%, ENSRNOG00000011553: 31%
Entrez Gene ID: 54777
Uniprot ID: Q8IYW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEEKVKEPKQSQSPAPIKQLEDLPMSIEEWASYSCPEEVLSVLKQDRSDSTVNPSSIQKPTYSLYFLDHL
• Gene Sequence: KEEKVKEPKQSQSPAPIKQLEDLPMSIEEWASYSCPEEVLSVLKQDRSDSTVNPSSIQKPTYSLYFLDHL
• Gene ID - Mouse: ENSMUSG00000049571
• Gene ID - Rat: ENSRNOG00000011553
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.