Anti CFAP46 pAb (ATL-HPA037786)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037786-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CFAP46
Alternative Gene Name: bA288G11.4, bA288G11.5, bB137A17.2, bB137A17.3, C10orf123, C10orf124, C10orf92, C10orf93, DKFZp434A1721, FLJ25954, TTC40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049571: 82%, ENSRNOG00000027374: 84%
Entrez Gene ID: 54777
Uniprot ID: Q8IYW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LAPDAFQIVLDSENEAKVSTGKNRGRFTYLCAKAWHHTVSVDKAAGHLRRLGNENDKERIQIWAELAKVARKQ |
| Gene Sequence | LAPDAFQIVLDSENEAKVSTGKNRGRFTYLCAKAWHHTVSVDKAAGHLRRLGNENDKERIQIWAELAKVARKQ |
| Gene ID - Mouse | ENSMUSG00000049571 |
| Gene ID - Rat | ENSRNOG00000027374 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CFAP46 pAb (ATL-HPA037786) | |
| Datasheet | Anti CFAP46 pAb (ATL-HPA037786) Datasheet (External Link) |
| Vendor Page | Anti CFAP46 pAb (ATL-HPA037786) at Atlas Antibodies |
| Documents & Links for Anti CFAP46 pAb (ATL-HPA037786) | |
| Datasheet | Anti CFAP46 pAb (ATL-HPA037786) Datasheet (External Link) |
| Vendor Page | Anti CFAP46 pAb (ATL-HPA037786) |
| Citations for Anti CFAP46 pAb (ATL-HPA037786) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |