Anti CFAP45 pAb (ATL-HPA042204)

Atlas Antibodies

SKU: ATL-HPA042204-25

• 
• 

Protein Description: cilia and flagella associated protein 45
Gene Name: CFAP45
Alternative Gene Name: CCDC19, NESG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026546: 81%, ENSRNOG00000008492: 83%
Entrez Gene ID: 25790
Uniprot ID: Q9UL16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDESLFGDIKSPAQGQSDSPIVLLRDKHTLQKTLTALGLDRKPETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWAS
• Gene Sequence: VDESLFGDIKSPAQGQSDSPIVLLRDKHTLQKTLTALGLDRKPETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWAS
• Gene ID - Mouse: ENSMUSG00000026546
• Gene ID - Rat: ENSRNOG00000008492
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.