Anti CFAP45 pAb (ATL-HPA042204)

Atlas Antibodies

Catalog No.:
ATL-HPA042204-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cilia and flagella associated protein 45
Gene Name: CFAP45
Alternative Gene Name: CCDC19, NESG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026546: 81%, ENSRNOG00000008492: 83%
Entrez Gene ID: 25790
Uniprot ID: Q9UL16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDESLFGDIKSPAQGQSDSPIVLLRDKHTLQKTLTALGLDRKPETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWAS
Gene Sequence VDESLFGDIKSPAQGQSDSPIVLLRDKHTLQKTLTALGLDRKPETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWAS
Gene ID - Mouse ENSMUSG00000026546
Gene ID - Rat ENSRNOG00000008492
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CFAP45 pAb (ATL-HPA042204)
Datasheet Anti CFAP45 pAb (ATL-HPA042204) Datasheet (External Link)
Vendor Page Anti CFAP45 pAb (ATL-HPA042204) at Atlas Antibodies

Documents & Links for Anti CFAP45 pAb (ATL-HPA042204)
Datasheet Anti CFAP45 pAb (ATL-HPA042204) Datasheet (External Link)
Vendor Page Anti CFAP45 pAb (ATL-HPA042204)