Anti CFAP410 pAb (ATL-HPA030283)

Atlas Antibodies

Catalog No.: ATL-HPA030283-25

Protein Description: chromosome 21 open reading frame 2
Gene Name: CFAP410
Alternative Gene Name: A2, LRRC76, YF5, C21orf2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020284: 86%, ENSRNOG00000001215: 85%
Entrez Gene ID: 755
Uniprot ID: O43822
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVSRCQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCCGTSPHRYRMTVLRTLPRLQKLDNQAVTEEELSRALSEGEEITAA
• Gene Sequence: PVSRCQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCCGTSPHRYRMTVLRTLPRLQKLDNQAVTEEELSRALSEGEEITAA
• Gene ID - Mouse: ENSMUSG00000020284
• Gene ID - Rat: ENSRNOG00000001215
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.