Anti CFAP410 pAb (ATL-HPA030283)

Atlas Antibodies

Catalog No.:
ATL-HPA030283-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 21 open reading frame 2
Gene Name: CFAP410
Alternative Gene Name: A2, LRRC76, YF5, C21orf2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020284: 86%, ENSRNOG00000001215: 85%
Entrez Gene ID: 755
Uniprot ID: O43822
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVSRCQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCCGTSPHRYRMTVLRTLPRLQKLDNQAVTEEELSRALSEGEEITAA
Gene Sequence PVSRCQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCCGTSPHRYRMTVLRTLPRLQKLDNQAVTEEELSRALSEGEEITAA
Gene ID - Mouse ENSMUSG00000020284
Gene ID - Rat ENSRNOG00000001215
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CFAP410 pAb (ATL-HPA030283)
Datasheet Anti CFAP410 pAb (ATL-HPA030283) Datasheet (External Link)
Vendor Page Anti CFAP410 pAb (ATL-HPA030283) at Atlas Antibodies

Documents & Links for Anti CFAP410 pAb (ATL-HPA030283)
Datasheet Anti CFAP410 pAb (ATL-HPA030283) Datasheet (External Link)
Vendor Page Anti CFAP410 pAb (ATL-HPA030283)