Anti CFAP36 pAb (ATL-HPA017061 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA017061-25

• 
• 

Protein Description: cilia and flagella associated protein 36
Gene Name: CFAP36
Alternative Gene Name: CCDC104, MGC15407
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020462: 97%, ENSRNOG00000003901: 97%
Entrez Gene ID: 112942
Uniprot ID: Q96G28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEEESKLTYTEIHQEYKELVEKLLEGYLKEIGINEDQFQEACTSPLAKTHTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQERNGVLPDCLTDGSDVVSDLEHEEMKILREVLRKSKEEYDQEEERKRK
• Gene Sequence: DEEESKLTYTEIHQEYKELVEKLLEGYLKEIGINEDQFQEACTSPLAKTHTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQERNGVLPDCLTDGSDVVSDLEHEEMKILREVLRKSKEEYDQEEERKRK
• Gene ID - Mouse: ENSMUSG00000020462
• Gene ID - Rat: ENSRNOG00000003901
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CFAP36 pAb (ATL-HPA017061 w/enhanced validation) – 1 Found

Datta, Poppy; Allamargot, Chantal; Hudson, Joseph S; Andersen, Emily K; Bhattarai, Sajag; Drack, Arlene V; Sheffield, Val C; Seo, Seongjin. Accumulation of non-outer segment proteins in the outer segment underlies photoreceptor degeneration in Bardet-Biedl syndrome. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(32):E4400-9.