Anti CFAP157 pAb (ATL-HPA021474 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA021474-25
  • Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-CFAP157 antibody. Corresponding CFAP157 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cilia and flagella associated protein 157
Gene Name: CFAP157
Alternative Gene Name: C9orf117
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038987: 70%, ENSRNOG00000039315: 74%
Entrez Gene ID: 286207
Uniprot ID: Q5JU67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEVTDKFTLLEEQVRKQENEFRDYAYNLEKKSVLDKDRLRKEIIQRVNLVANEFHKVTTNRMWETTKRAIKENNGITLQMARVSQQGMKLLQENEQL
Gene Sequence EEVTDKFTLLEEQVRKQENEFRDYAYNLEKKSVLDKDRLRKEIIQRVNLVANEFHKVTTNRMWETTKRAIKENNGITLQMARVSQQGMKLLQENEQL
Gene ID - Mouse ENSMUSG00000038987
Gene ID - Rat ENSRNOG00000039315
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CFAP157 pAb (ATL-HPA021474 w/enhanced validation)
Datasheet Anti CFAP157 pAb (ATL-HPA021474 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CFAP157 pAb (ATL-HPA021474 w/enhanced validation)