Anti CETN3 pAb (ATL-HPA035608)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035608-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CETN3
Alternative Gene Name: CEN3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021537: 100%, ENSRNOG00000048563: 100%
Entrez Gene ID: 1070
Uniprot ID: O15182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILK |
| Gene Sequence | AMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILK |
| Gene ID - Mouse | ENSMUSG00000021537 |
| Gene ID - Rat | ENSRNOG00000048563 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CETN3 pAb (ATL-HPA035608) | |
| Datasheet | Anti CETN3 pAb (ATL-HPA035608) Datasheet (External Link) |
| Vendor Page | Anti CETN3 pAb (ATL-HPA035608) at Atlas Antibodies |
| Documents & Links for Anti CETN3 pAb (ATL-HPA035608) | |
| Datasheet | Anti CETN3 pAb (ATL-HPA035608) Datasheet (External Link) |
| Vendor Page | Anti CETN3 pAb (ATL-HPA035608) |