Anti CETN3 pAb (ATL-HPA035608)

Atlas Antibodies

Catalog No.:
ATL-HPA035608-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: centrin, EF-hand protein, 3
Gene Name: CETN3
Alternative Gene Name: CEN3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021537: 100%, ENSRNOG00000048563: 100%
Entrez Gene ID: 1070
Uniprot ID: O15182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILK
Gene Sequence AMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILK
Gene ID - Mouse ENSMUSG00000021537
Gene ID - Rat ENSRNOG00000048563
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CETN3 pAb (ATL-HPA035608)
Datasheet Anti CETN3 pAb (ATL-HPA035608) Datasheet (External Link)
Vendor Page Anti CETN3 pAb (ATL-HPA035608) at Atlas Antibodies

Documents & Links for Anti CETN3 pAb (ATL-HPA035608)
Datasheet Anti CETN3 pAb (ATL-HPA035608) Datasheet (External Link)
Vendor Page Anti CETN3 pAb (ATL-HPA035608)