Anti CETN3 pAb (ATL-HPA035608)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035608-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CETN3
Alternative Gene Name: CEN3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021537: 100%, ENSRNOG00000048563: 100%
Entrez Gene ID: 1070
Uniprot ID: O15182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILK |
Gene Sequence | AMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILK |
Gene ID - Mouse | ENSMUSG00000021537 |
Gene ID - Rat | ENSRNOG00000048563 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CETN3 pAb (ATL-HPA035608) | |
Datasheet | Anti CETN3 pAb (ATL-HPA035608) Datasheet (External Link) |
Vendor Page | Anti CETN3 pAb (ATL-HPA035608) at Atlas Antibodies |
Documents & Links for Anti CETN3 pAb (ATL-HPA035608) | |
Datasheet | Anti CETN3 pAb (ATL-HPA035608) Datasheet (External Link) |
Vendor Page | Anti CETN3 pAb (ATL-HPA035608) |