Anti CES5A pAb (ATL-HPA047635 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047635-25

• 
• 

Protein Description: carboxylesterase 5A
Gene Name: CES5A
Alternative Gene Name: CAUXIN, CES4C1, CES5, CES7, FLJ31547
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058019: 67%, ENSRNOG00000025710: 69%
Entrez Gene ID: 221223
Uniprot ID: Q6NT32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGSLRFTNPQPASPWDNLREATSYPNLCLQNSEWLLLDQHMLKVHYPKFGVS
• Gene Sequence: LGSLRFTNPQPASPWDNLREATSYPNLCLQNSEWLLLDQHMLKVHYPKFGVS
• Gene ID - Mouse: ENSMUSG00000058019
• Gene ID - Rat: ENSRNOG00000025710
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.