Anti CES4A pAb (ATL-HPA035701)

Atlas Antibodies

SKU:
ATL-HPA035701-25
  • Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line PC-3 shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: carboxylesterase 4A
Gene Name: CES4A
Alternative Gene Name: CES8, FLJ37464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060560: 67%, ENSRNOG00000014257: 68%
Entrez Gene ID: 283848
Uniprot ID: Q5XG92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDPGNVTLFGQSAGAMSISGLMMSPLASGLFHRAISQSGTALFRLFITSNPLKVAKKVAHLAGCNHNSTQILVNCLRALSGTKVMRVSNKMRFLQLNFQRDPEEIIWSMSPVVDGVVIPDDPLVLLTQGKVSSVPYL
Gene Sequence GDPGNVTLFGQSAGAMSISGLMMSPLASGLFHRAISQSGTALFRLFITSNPLKVAKKVAHLAGCNHNSTQILVNCLRALSGTKVMRVSNKMRFLQLNFQRDPEEIIWSMSPVVDGVVIPDDPLVLLTQGKVSSVPYL
Gene ID - Mouse ENSMUSG00000060560
Gene ID - Rat ENSRNOG00000014257
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CES4A pAb (ATL-HPA035701)
Datasheet Anti CES4A pAb (ATL-HPA035701) Datasheet (External Link)
Vendor Page Anti CES4A pAb (ATL-HPA035701) at Atlas Antibodies

Documents & Links for Anti CES4A pAb (ATL-HPA035701)
Datasheet Anti CES4A pAb (ATL-HPA035701) Datasheet (External Link)
Vendor Page Anti CES4A pAb (ATL-HPA035701)