Anti CES3 pAb (ATL-HPA041008)

Atlas Antibodies

Catalog No.:
ATL-HPA041008-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: carboxylesterase 3
Gene Name: CES3
Alternative Gene Name: ES31, FLJ21736
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062181: 62%, ENSRNOG00000015519: 37%
Entrez Gene ID: 23491
Uniprot ID: Q6UWW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVLTSLDVPPEMMPTVIDEYLGSNSDAQAKCQAFQEFMGDVFINVPTVSFSRYLRDSGSPVFFYEFQHRPSSF
Gene Sequence PVLTSLDVPPEMMPTVIDEYLGSNSDAQAKCQAFQEFMGDVFINVPTVSFSRYLRDSGSPVFFYEFQHRPSSF
Gene ID - Mouse ENSMUSG00000062181
Gene ID - Rat ENSRNOG00000015519
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CES3 pAb (ATL-HPA041008)
Datasheet Anti CES3 pAb (ATL-HPA041008) Datasheet (External Link)
Vendor Page Anti CES3 pAb (ATL-HPA041008) at Atlas Antibodies

Documents & Links for Anti CES3 pAb (ATL-HPA041008)
Datasheet Anti CES3 pAb (ATL-HPA041008) Datasheet (External Link)
Vendor Page Anti CES3 pAb (ATL-HPA041008)