Anti CES3 pAb (ATL-HPA041008)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041008-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CES3
Alternative Gene Name: ES31, FLJ21736
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062181: 62%, ENSRNOG00000015519: 37%
Entrez Gene ID: 23491
Uniprot ID: Q6UWW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PVLTSLDVPPEMMPTVIDEYLGSNSDAQAKCQAFQEFMGDVFINVPTVSFSRYLRDSGSPVFFYEFQHRPSSF |
Gene Sequence | PVLTSLDVPPEMMPTVIDEYLGSNSDAQAKCQAFQEFMGDVFINVPTVSFSRYLRDSGSPVFFYEFQHRPSSF |
Gene ID - Mouse | ENSMUSG00000062181 |
Gene ID - Rat | ENSRNOG00000015519 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CES3 pAb (ATL-HPA041008) | |
Datasheet | Anti CES3 pAb (ATL-HPA041008) Datasheet (External Link) |
Vendor Page | Anti CES3 pAb (ATL-HPA041008) at Atlas Antibodies |
Documents & Links for Anti CES3 pAb (ATL-HPA041008) | |
Datasheet | Anti CES3 pAb (ATL-HPA041008) Datasheet (External Link) |
Vendor Page | Anti CES3 pAb (ATL-HPA041008) |