Anti CES2 pAb (ATL-HPA018897 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018897-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CES2
Alternative Gene Name: CE-2, CES2A1, iCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050097: 66%, ENSRNOG00000039079: 65%
Entrez Gene ID: 8824
Uniprot ID: O00748
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEFQHQP |
| Gene Sequence | PVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEFQHQP |
| Gene ID - Mouse | ENSMUSG00000050097 |
| Gene ID - Rat | ENSRNOG00000039079 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CES2 pAb (ATL-HPA018897 w/enhanced validation) | |
| Datasheet | Anti CES2 pAb (ATL-HPA018897 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CES2 pAb (ATL-HPA018897 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CES2 pAb (ATL-HPA018897 w/enhanced validation) | |
| Datasheet | Anti CES2 pAb (ATL-HPA018897 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CES2 pAb (ATL-HPA018897 w/enhanced validation) |
| Citations for Anti CES2 pAb (ATL-HPA018897 w/enhanced validation) – 4 Found |
| Chen, Yihui; Capello, Michela; Rios Perez, Mayrim V; Vykoukal, Jody V; Roife, David; Kang, Ya'an; Prakash, Laura R; Katayama, Hiroyuki; Irajizad, Ehsan; Fleury, Alia; Ferri-Borgogno, Sammy; Baluya, Dodge L; Dennison, Jennifer B; Do, Kim-Anh; Fiehn, Oliver; Maitra, Anirban; Wang, Huamin; Chiao, Paul J; Katz, Matthew H G; Fleming, Jason B; Hanash, Samir M; Fahrmann, Johannes F. CES2 sustains HNF4α expression to promote pancreatic adenocarcinoma progression through an epoxide hydrolase-dependent regulatory loop. Molecular Metabolism. 2022;56( 34971802):101426. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Wang, Oliver H; Azizian, Nancy; Guo, Ming; Capello, Michela; Deng, Defeng; Zang, Fenglin; Fry, Jason; Katz, Matthew H; Fleming, Jason B; Lee, Jeffrey E; Wolff, Robert A; Hanash, Samir; Wang, Huamin; Maitra, Anirban. Prognostic and Functional Significance of MAP4K5 in Pancreatic Cancer. Plos One. 11(3):e0152300. PubMed |
| Kailass, Karishma; Sadovski, Oleg; Capello, Michela; Kang, Ya'an; Fleming, Jason B; Hanash, Samir M; Beharry, Andrew A. Measuring human carboxylesterase 2 activity in pancreatic cancer patient-derived xenografts using a ratiometric fluorescent chemosensor. Chemical Science. 2019;10(36):8428-8437. PubMed |