Anti CES2 pAb (ATL-HPA018897 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA018897-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: carboxylesterase 2
Gene Name: CES2
Alternative Gene Name: CE-2, CES2A1, iCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050097: 66%, ENSRNOG00000039079: 65%
Entrez Gene ID: 8824
Uniprot ID: O00748
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEFQHQP
Gene Sequence PVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEFQHQP
Gene ID - Mouse ENSMUSG00000050097
Gene ID - Rat ENSRNOG00000039079
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CES2 pAb (ATL-HPA018897 w/enhanced validation)
Datasheet Anti CES2 pAb (ATL-HPA018897 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CES2 pAb (ATL-HPA018897 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CES2 pAb (ATL-HPA018897 w/enhanced validation)
Datasheet Anti CES2 pAb (ATL-HPA018897 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CES2 pAb (ATL-HPA018897 w/enhanced validation)
Citations for Anti CES2 pAb (ATL-HPA018897 w/enhanced validation) – 4 Found
Chen, Yihui; Capello, Michela; Rios Perez, Mayrim V; Vykoukal, Jody V; Roife, David; Kang, Ya'an; Prakash, Laura R; Katayama, Hiroyuki; Irajizad, Ehsan; Fleury, Alia; Ferri-Borgogno, Sammy; Baluya, Dodge L; Dennison, Jennifer B; Do, Kim-Anh; Fiehn, Oliver; Maitra, Anirban; Wang, Huamin; Chiao, Paul J; Katz, Matthew H G; Fleming, Jason B; Hanash, Samir M; Fahrmann, Johannes F. CES2 sustains HNF4α expression to promote pancreatic adenocarcinoma progression through an epoxide hydrolase-dependent regulatory loop. Molecular Metabolism. 2022;56( 34971802):101426.  PubMed
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed
Wang, Oliver H; Azizian, Nancy; Guo, Ming; Capello, Michela; Deng, Defeng; Zang, Fenglin; Fry, Jason; Katz, Matthew H; Fleming, Jason B; Lee, Jeffrey E; Wolff, Robert A; Hanash, Samir; Wang, Huamin; Maitra, Anirban. Prognostic and Functional Significance of MAP4K5 in Pancreatic Cancer. Plos One. 11(3):e0152300.  PubMed
Kailass, Karishma; Sadovski, Oleg; Capello, Michela; Kang, Ya'an; Fleming, Jason B; Hanash, Samir M; Beharry, Andrew A. Measuring human carboxylesterase 2 activity in pancreatic cancer patient-derived xenografts using a ratiometric fluorescent chemosensor. Chemical Science. 2019;10(36):8428-8437.  PubMed