Anti CES1 pAb (ATL-HPA046717 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA046717-25

Protein Description: carboxylesterase 1
Gene Name: CES1
Alternative Gene Name: CEH, CES1A1, CES1A2, CES2, HMSE, HMSE1, SES1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061959: 73%, ENSRNOG00000015438: 73%
Entrez Gene ID: 1066
Uniprot ID: P23141
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQTEHIEL
• Gene Sequence: HWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQTEHIEL
• Gene ID - Mouse: ENSMUSG00000061959
• Gene ID - Rat: ENSRNOG00000015438
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CES1 pAb (ATL-HPA046717 w/enhanced validation) – 1 Found

Yan, Victoria C; Muller, Florian L. Advantages of the Parent Nucleoside GS-441524 over Remdesivir for Covid-19 Treatment. Acs Medicinal Chemistry Letters. 2020;11(7):1361-1366.