Anti CES1 pAb (ATL-HPA046717 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046717-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CES1
Alternative Gene Name: CEH, CES1A1, CES1A2, CES2, HMSE, HMSE1, SES1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061959: 73%, ENSRNOG00000015438: 73%
Entrez Gene ID: 1066
Uniprot ID: P23141
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQTEHIEL |
| Gene Sequence | HWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQTEHIEL |
| Gene ID - Mouse | ENSMUSG00000061959 |
| Gene ID - Rat | ENSRNOG00000015438 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CES1 pAb (ATL-HPA046717 w/enhanced validation) | |
| Datasheet | Anti CES1 pAb (ATL-HPA046717 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CES1 pAb (ATL-HPA046717 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CES1 pAb (ATL-HPA046717 w/enhanced validation) | |
| Datasheet | Anti CES1 pAb (ATL-HPA046717 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CES1 pAb (ATL-HPA046717 w/enhanced validation) |
| Citations for Anti CES1 pAb (ATL-HPA046717 w/enhanced validation) – 1 Found |
| Yan, Victoria C; Muller, Florian L. Advantages of the Parent Nucleoside GS-441524 over Remdesivir for Covid-19 Treatment. Acs Medicinal Chemistry Letters. 2020;11(7):1361-1366. PubMed |