Anti CERS3 pAb (ATL-HPA024356)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024356-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CERS3
Alternative Gene Name: LASS3, MGC27091
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030510: 73%, ENSRNOG00000013823: 68%
Entrez Gene ID: 204219
Uniprot ID: Q8IU89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NRCIFMKSIQDVRSDDEDYEEEEEEEEEEATKGKEMDCLKNGLGAERHLIPNGQH |
| Gene Sequence | NRCIFMKSIQDVRSDDEDYEEEEEEEEEEATKGKEMDCLKNGLGAERHLIPNGQH |
| Gene ID - Mouse | ENSMUSG00000030510 |
| Gene ID - Rat | ENSRNOG00000013823 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CERS3 pAb (ATL-HPA024356) | |
| Datasheet | Anti CERS3 pAb (ATL-HPA024356) Datasheet (External Link) |
| Vendor Page | Anti CERS3 pAb (ATL-HPA024356) at Atlas Antibodies |
| Documents & Links for Anti CERS3 pAb (ATL-HPA024356) | |
| Datasheet | Anti CERS3 pAb (ATL-HPA024356) Datasheet (External Link) |
| Vendor Page | Anti CERS3 pAb (ATL-HPA024356) |