Anti CERS3 pAb (ATL-HPA024356)

Atlas Antibodies

SKU:
ATL-HPA024356-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ceramide synthase 3
Gene Name: CERS3
Alternative Gene Name: LASS3, MGC27091
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030510: 73%, ENSRNOG00000013823: 68%
Entrez Gene ID: 204219
Uniprot ID: Q8IU89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRCIFMKSIQDVRSDDEDYEEEEEEEEEEATKGKEMDCLKNGLGAERHLIPNGQH
Gene Sequence NRCIFMKSIQDVRSDDEDYEEEEEEEEEEATKGKEMDCLKNGLGAERHLIPNGQH
Gene ID - Mouse ENSMUSG00000030510
Gene ID - Rat ENSRNOG00000013823
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CERS3 pAb (ATL-HPA024356)
Datasheet Anti CERS3 pAb (ATL-HPA024356) Datasheet (External Link)
Vendor Page Anti CERS3 pAb (ATL-HPA024356) at Atlas Antibodies

Documents & Links for Anti CERS3 pAb (ATL-HPA024356)
Datasheet Anti CERS3 pAb (ATL-HPA024356) Datasheet (External Link)
Vendor Page Anti CERS3 pAb (ATL-HPA024356)