Anti CERS2 pAb (ATL-HPA078737)

Atlas Antibodies

Catalog No.:
ATL-HPA078737-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ceramide synthase 2
Gene Name: CERS2
Alternative Gene Name: FLJ10243, LASS2, SP260
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015714: 91%, ENSRNOG00000021138: 94%
Entrez Gene ID: 29956
Uniprot ID: Q96G23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKN
Gene Sequence MAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKN
Gene ID - Mouse ENSMUSG00000015714
Gene ID - Rat ENSRNOG00000021138
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CERS2 pAb (ATL-HPA078737)
Datasheet Anti CERS2 pAb (ATL-HPA078737) Datasheet (External Link)
Vendor Page Anti CERS2 pAb (ATL-HPA078737) at Atlas Antibodies

Documents & Links for Anti CERS2 pAb (ATL-HPA078737)
Datasheet Anti CERS2 pAb (ATL-HPA078737) Datasheet (External Link)
Vendor Page Anti CERS2 pAb (ATL-HPA078737)