Anti CERS2 pAb (ATL-HPA078737)

Atlas Antibodies

Catalog No.: ATL-HPA078737-25

Protein Description: ceramide synthase 2
Gene Name: CERS2
Alternative Gene Name: FLJ10243, LASS2, SP260
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015714: 91%, ENSRNOG00000021138: 94%
Entrez Gene ID: 29956
Uniprot ID: Q96G23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKN
• Gene Sequence: MAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKN
• Gene ID - Mouse: ENSMUSG00000015714
• Gene ID - Rat: ENSRNOG00000021138
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.