Anti CERKL pAb (ATL-HPA035444)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035444-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CERKL
Alternative Gene Name: RP26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075256: 73%, ENSRNOG00000030212: 73%
Entrez Gene ID: 375298
Uniprot ID: Q49MI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSMEEMI |
| Gene Sequence | IARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSMEEMI |
| Gene ID - Mouse | ENSMUSG00000075256 |
| Gene ID - Rat | ENSRNOG00000030212 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CERKL pAb (ATL-HPA035444) | |
| Datasheet | Anti CERKL pAb (ATL-HPA035444) Datasheet (External Link) |
| Vendor Page | Anti CERKL pAb (ATL-HPA035444) at Atlas Antibodies |
| Documents & Links for Anti CERKL pAb (ATL-HPA035444) | |
| Datasheet | Anti CERKL pAb (ATL-HPA035444) Datasheet (External Link) |
| Vendor Page | Anti CERKL pAb (ATL-HPA035444) |
| Citations for Anti CERKL pAb (ATL-HPA035444) – 1 Found |
| Hu, Xuebin; Lu, Zhaojing; Yu, Shanshan; Reilly, James; Liu, Fei; Jia, Danna; Qin, Yayun; Han, Shanshan; Liu, Xiliang; Qu, Zhen; Lv, Yuexia; Li, Jingzhen; Huang, Yuwen; Jiang, Tao; Jia, Haibo; Wang, Qing; Liu, Jingyu; Shu, Xinhua; Tang, Zhaohui; Liu, Mugen. CERKL regulates autophagy via the NAD-dependent deacetylase SIRT1. Autophagy. 2019;15(3):453-465. PubMed |