Anti CERKL pAb (ATL-HPA035444)

Atlas Antibodies

Catalog No.:
ATL-HPA035444-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ceramide kinase-like
Gene Name: CERKL
Alternative Gene Name: RP26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075256: 73%, ENSRNOG00000030212: 73%
Entrez Gene ID: 375298
Uniprot ID: Q49MI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSMEEMI
Gene Sequence IARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSMEEMI
Gene ID - Mouse ENSMUSG00000075256
Gene ID - Rat ENSRNOG00000030212
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CERKL pAb (ATL-HPA035444)
Datasheet Anti CERKL pAb (ATL-HPA035444) Datasheet (External Link)
Vendor Page Anti CERKL pAb (ATL-HPA035444) at Atlas Antibodies

Documents & Links for Anti CERKL pAb (ATL-HPA035444)
Datasheet Anti CERKL pAb (ATL-HPA035444) Datasheet (External Link)
Vendor Page Anti CERKL pAb (ATL-HPA035444)
Citations for Anti CERKL pAb (ATL-HPA035444) – 1 Found
Hu, Xuebin; Lu, Zhaojing; Yu, Shanshan; Reilly, James; Liu, Fei; Jia, Danna; Qin, Yayun; Han, Shanshan; Liu, Xiliang; Qu, Zhen; Lv, Yuexia; Li, Jingzhen; Huang, Yuwen; Jiang, Tao; Jia, Haibo; Wang, Qing; Liu, Jingyu; Shu, Xinhua; Tang, Zhaohui; Liu, Mugen. CERKL regulates autophagy via the NAD-dependent deacetylase SIRT1. Autophagy. 2019;15(3):453-465.  PubMed