Anti CERKL pAb (ATL-HPA035443)

Atlas Antibodies

Catalog No.:
ATL-HPA035443-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ceramide kinase-like
Gene Name: CERKL
Alternative Gene Name: RP26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075256: 57%, ENSRNOG00000030212: 51%
Entrez Gene ID: 375298
Uniprot ID: Q49MI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RNRVSALEGGREEEAPPEAAAVPPALLTSPQQTEAAAERILLRGIFEIGRDSCDVVLSERALRWRPIQPERPAGDSKYDLLCKEEFIELKD
Gene Sequence RNRVSALEGGREEEAPPEAAAVPPALLTSPQQTEAAAERILLRGIFEIGRDSCDVVLSERALRWRPIQPERPAGDSKYDLLCKEEFIELKD
Gene ID - Mouse ENSMUSG00000075256
Gene ID - Rat ENSRNOG00000030212
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CERKL pAb (ATL-HPA035443)
Datasheet Anti CERKL pAb (ATL-HPA035443) Datasheet (External Link)
Vendor Page Anti CERKL pAb (ATL-HPA035443) at Atlas Antibodies

Documents & Links for Anti CERKL pAb (ATL-HPA035443)
Datasheet Anti CERKL pAb (ATL-HPA035443) Datasheet (External Link)
Vendor Page Anti CERKL pAb (ATL-HPA035443)