Anti CERKL pAb (ATL-HPA035443)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035443-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CERKL
Alternative Gene Name: RP26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075256: 57%, ENSRNOG00000030212: 51%
Entrez Gene ID: 375298
Uniprot ID: Q49MI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RNRVSALEGGREEEAPPEAAAVPPALLTSPQQTEAAAERILLRGIFEIGRDSCDVVLSERALRWRPIQPERPAGDSKYDLLCKEEFIELKD |
| Gene Sequence | RNRVSALEGGREEEAPPEAAAVPPALLTSPQQTEAAAERILLRGIFEIGRDSCDVVLSERALRWRPIQPERPAGDSKYDLLCKEEFIELKD |
| Gene ID - Mouse | ENSMUSG00000075256 |
| Gene ID - Rat | ENSRNOG00000030212 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CERKL pAb (ATL-HPA035443) | |
| Datasheet | Anti CERKL pAb (ATL-HPA035443) Datasheet (External Link) |
| Vendor Page | Anti CERKL pAb (ATL-HPA035443) at Atlas Antibodies |
| Documents & Links for Anti CERKL pAb (ATL-HPA035443) | |
| Datasheet | Anti CERKL pAb (ATL-HPA035443) Datasheet (External Link) |
| Vendor Page | Anti CERKL pAb (ATL-HPA035443) |