Anti CERKL pAb (ATL-HPA035443)
Atlas Antibodies
- SKU:
- ATL-HPA035443-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CERKL
Alternative Gene Name: RP26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075256: 57%, ENSRNOG00000030212: 51%
Entrez Gene ID: 375298
Uniprot ID: Q49MI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RNRVSALEGGREEEAPPEAAAVPPALLTSPQQTEAAAERILLRGIFEIGRDSCDVVLSERALRWRPIQPERPAGDSKYDLLCKEEFIELKD |
Gene Sequence | RNRVSALEGGREEEAPPEAAAVPPALLTSPQQTEAAAERILLRGIFEIGRDSCDVVLSERALRWRPIQPERPAGDSKYDLLCKEEFIELKD |
Gene ID - Mouse | ENSMUSG00000075256 |
Gene ID - Rat | ENSRNOG00000030212 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CERKL pAb (ATL-HPA035443) | |
Datasheet | Anti CERKL pAb (ATL-HPA035443) Datasheet (External Link) |
Vendor Page | Anti CERKL pAb (ATL-HPA035443) at Atlas Antibodies |
Documents & Links for Anti CERKL pAb (ATL-HPA035443) | |
Datasheet | Anti CERKL pAb (ATL-HPA035443) Datasheet (External Link) |
Vendor Page | Anti CERKL pAb (ATL-HPA035443) |