Anti CER1 pAb (ATL-HPA019917)

Atlas Antibodies

SKU: ATL-HPA019917-100

• 
• 

Protein Description: cerberus 1, DAN family BMP antagonist
Gene Name: CER1
Alternative Gene Name: DAND4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038192: 72%, ENSRNOG00000010518: 73%
Entrez Gene ID: 9350
Uniprot ID: O95813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDSEPFPPGTQSLIQPIDGMKMEKSPLREEAKKFWHHFMFRKTPASQGVILPIKSHEVHWETCRTVPFSQTITHEGCEKVVVQNNL
• Gene Sequence: SDSEPFPPGTQSLIQPIDGMKMEKSPLREEAKKFWHHFMFRKTPASQGVILPIKSHEVHWETCRTVPFSQTITHEGCEKVVVQNNL
• Gene ID - Mouse: ENSMUSG00000038192
• Gene ID - Rat: ENSRNOG00000010518
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.