Anti CEP95 pAb (ATL-HPA052426)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052426-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CEP95
Alternative Gene Name: CCDC45, DKFZp667E1824
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018372: 87%, ENSRNOG00000014354: 87%
Entrez Gene ID: 90799
Uniprot ID: Q96GE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ALRRHDLLTTLVKKEYEHNKRLQDFKDCIRRQRLTQSKIKENRQQIVRARKYYDDYRVQLCAKMMRMRTREEMIFKKLFEEGLNIQKQRLRDLRNYAKEKRDEQRRRHQDELDSM |
Gene Sequence | ALRRHDLLTTLVKKEYEHNKRLQDFKDCIRRQRLTQSKIKENRQQIVRARKYYDDYRVQLCAKMMRMRTREEMIFKKLFEEGLNIQKQRLRDLRNYAKEKRDEQRRRHQDELDSM |
Gene ID - Mouse | ENSMUSG00000018372 |
Gene ID - Rat | ENSRNOG00000014354 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEP95 pAb (ATL-HPA052426) | |
Datasheet | Anti CEP95 pAb (ATL-HPA052426) Datasheet (External Link) |
Vendor Page | Anti CEP95 pAb (ATL-HPA052426) at Atlas Antibodies |
Documents & Links for Anti CEP95 pAb (ATL-HPA052426) | |
Datasheet | Anti CEP95 pAb (ATL-HPA052426) Datasheet (External Link) |
Vendor Page | Anti CEP95 pAb (ATL-HPA052426) |