Anti CEP89 pAb (ATL-HPA040056)

Atlas Antibodies

Catalog No.:
ATL-HPA040056-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 89kDa
Gene Name: CEP89
Alternative Gene Name: CCDC123, FLJ14640
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023072: 79%, ENSRNOG00000012140: 78%
Entrez Gene ID: 84902
Uniprot ID: Q96ST8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KINRKSQKKIEVLKKQVEKAMGNEMSAHQYLANLVGLAENITQERDSLMCLAKCLESEKDGVLNKVIKSNIRLGKLEEKVKGYKKQAALKLGDISHRLLEQQEDFAGKTAQYRQEM
Gene Sequence KINRKSQKKIEVLKKQVEKAMGNEMSAHQYLANLVGLAENITQERDSLMCLAKCLESEKDGVLNKVIKSNIRLGKLEEKVKGYKKQAALKLGDISHRLLEQQEDFAGKTAQYRQEM
Gene ID - Mouse ENSMUSG00000023072
Gene ID - Rat ENSRNOG00000012140
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP89 pAb (ATL-HPA040056)
Datasheet Anti CEP89 pAb (ATL-HPA040056) Datasheet (External Link)
Vendor Page Anti CEP89 pAb (ATL-HPA040056) at Atlas Antibodies

Documents & Links for Anti CEP89 pAb (ATL-HPA040056)
Datasheet Anti CEP89 pAb (ATL-HPA040056) Datasheet (External Link)
Vendor Page Anti CEP89 pAb (ATL-HPA040056)
Citations for Anti CEP89 pAb (ATL-HPA040056) – 1 Found
Jodoin, Jeanne N; Shboul, Mohammad; Albrecht, Todd R; Lee, Ethan; Wagner, Eric J; Reversade, Bruno; Lee, Laura A. The snRNA-processing complex, Integrator, is required for ciliogenesis and dynein recruitment to the nuclear envelope via distinct mechanisms. Biology Open. 2013;2(12):1390-6.  PubMed