Anti CEP89 pAb (ATL-HPA040056)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040056-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CEP89
Alternative Gene Name: CCDC123, FLJ14640
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023072: 79%, ENSRNOG00000012140: 78%
Entrez Gene ID: 84902
Uniprot ID: Q96ST8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KINRKSQKKIEVLKKQVEKAMGNEMSAHQYLANLVGLAENITQERDSLMCLAKCLESEKDGVLNKVIKSNIRLGKLEEKVKGYKKQAALKLGDISHRLLEQQEDFAGKTAQYRQEM |
Gene Sequence | KINRKSQKKIEVLKKQVEKAMGNEMSAHQYLANLVGLAENITQERDSLMCLAKCLESEKDGVLNKVIKSNIRLGKLEEKVKGYKKQAALKLGDISHRLLEQQEDFAGKTAQYRQEM |
Gene ID - Mouse | ENSMUSG00000023072 |
Gene ID - Rat | ENSRNOG00000012140 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEP89 pAb (ATL-HPA040056) | |
Datasheet | Anti CEP89 pAb (ATL-HPA040056) Datasheet (External Link) |
Vendor Page | Anti CEP89 pAb (ATL-HPA040056) at Atlas Antibodies |
Documents & Links for Anti CEP89 pAb (ATL-HPA040056) | |
Datasheet | Anti CEP89 pAb (ATL-HPA040056) Datasheet (External Link) |
Vendor Page | Anti CEP89 pAb (ATL-HPA040056) |
Citations for Anti CEP89 pAb (ATL-HPA040056) – 1 Found |
Jodoin, Jeanne N; Shboul, Mohammad; Albrecht, Todd R; Lee, Ethan; Wagner, Eric J; Reversade, Bruno; Lee, Laura A. The snRNA-processing complex, Integrator, is required for ciliogenesis and dynein recruitment to the nuclear envelope via distinct mechanisms. Biology Open. 2013;2(12):1390-6. PubMed |