Anti CEP85L pAb (ATL-HPA029137)

Atlas Antibodies

Catalog No.:
ATL-HPA029137-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 85kDa-like
Gene Name: CEP85L
Alternative Gene Name: bA57K17.2, C6orf204, NY-BR-15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038594: 90%, ENSRNOG00000000414: 90%
Entrez Gene ID: 387119
Uniprot ID: Q5SZL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDSYSLAPWQQQQIEDFRQGSETPMQVLTGSSRQSYSPGYQDFSKWESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQ
Gene Sequence EDSYSLAPWQQQQIEDFRQGSETPMQVLTGSSRQSYSPGYQDFSKWESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQ
Gene ID - Mouse ENSMUSG00000038594
Gene ID - Rat ENSRNOG00000000414
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP85L pAb (ATL-HPA029137)
Datasheet Anti CEP85L pAb (ATL-HPA029137) Datasheet (External Link)
Vendor Page Anti CEP85L pAb (ATL-HPA029137) at Atlas Antibodies

Documents & Links for Anti CEP85L pAb (ATL-HPA029137)
Datasheet Anti CEP85L pAb (ATL-HPA029137) Datasheet (External Link)
Vendor Page Anti CEP85L pAb (ATL-HPA029137)
Citations for Anti CEP85L pAb (ATL-HPA029137) – 1 Found
Jakobsen, Lis; Vanselow, Katja; Skogs, Marie; Toyoda, Yusuke; Lundberg, Emma; Poser, Ina; Falkenby, Lasse G; Bennetzen, Martin; Westendorf, Jens; Nigg, Erich A; Uhlen, Mathias; Hyman, Anthony A; Andersen, Jens S. Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods. The Embo Journal. 2011;30(8):1520-35.  PubMed