Anti CEP85L pAb (ATL-HPA029137)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029137-25
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/87022/158728/atl-hpa029137_anti-cep85l-pab-atl-hpa029137_40362__69324.1681109905.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CEP85L
Alternative Gene Name: bA57K17.2, C6orf204, NY-BR-15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038594: 90%, ENSRNOG00000000414: 90%
Entrez Gene ID: 387119
Uniprot ID: Q5SZL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EDSYSLAPWQQQQIEDFRQGSETPMQVLTGSSRQSYSPGYQDFSKWESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQ |
| Gene Sequence | EDSYSLAPWQQQQIEDFRQGSETPMQVLTGSSRQSYSPGYQDFSKWESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQ |
| Gene ID - Mouse | ENSMUSG00000038594 |
| Gene ID - Rat | ENSRNOG00000000414 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEP85L pAb (ATL-HPA029137) | |
| Datasheet | Anti CEP85L pAb (ATL-HPA029137) Datasheet (External Link) |
| Vendor Page | Anti CEP85L pAb (ATL-HPA029137) at Atlas Antibodies |
| Documents & Links for Anti CEP85L pAb (ATL-HPA029137) | |
| Datasheet | Anti CEP85L pAb (ATL-HPA029137) Datasheet (External Link) |
| Vendor Page | Anti CEP85L pAb (ATL-HPA029137) |
| Citations for Anti CEP85L pAb (ATL-HPA029137) – 1 Found |
| Jakobsen, Lis; Vanselow, Katja; Skogs, Marie; Toyoda, Yusuke; Lundberg, Emma; Poser, Ina; Falkenby, Lasse G; Bennetzen, Martin; Westendorf, Jens; Nigg, Erich A; Uhlen, Mathias; Hyman, Anthony A; Andersen, Jens S. Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods. The Embo Journal. 2011;30(8):1520-35. PubMed |