Anti CEP83 pAb (ATL-HPA038161)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038161-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CEP83
Alternative Gene Name: CCDC41, NY-REN-58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020024: 89%, ENSRNOG00000007859: 90%
Entrez Gene ID: 51134
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LKRLQEKVEVLEAKKEELETENQVLNRQNVPFEDYTRLQKRLKDIQRRHNEFRSLILVPNMPPTASINPVSFQSSAMVPSMELPFPPHMQEEQHQRELSL |
| Gene Sequence | LKRLQEKVEVLEAKKEELETENQVLNRQNVPFEDYTRLQKRLKDIQRRHNEFRSLILVPNMPPTASINPVSFQSSAMVPSMELPFPPHMQEEQHQRELSL |
| Gene ID - Mouse | ENSMUSG00000020024 |
| Gene ID - Rat | ENSRNOG00000007859 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEP83 pAb (ATL-HPA038161) | |
| Datasheet | Anti CEP83 pAb (ATL-HPA038161) Datasheet (External Link) |
| Vendor Page | Anti CEP83 pAb (ATL-HPA038161) at Atlas Antibodies |
| Documents & Links for Anti CEP83 pAb (ATL-HPA038161) | |
| Datasheet | Anti CEP83 pAb (ATL-HPA038161) Datasheet (External Link) |
| Vendor Page | Anti CEP83 pAb (ATL-HPA038161) |
| Citations for Anti CEP83 pAb (ATL-HPA038161) – 12 Found |
| Xu, Qingwen; Zhang, Yuxia; Wei, Qing; Huang, Yan; Hu, Jinghua; Ling, Kun. Phosphatidylinositol phosphate kinase PIPKIγ and phosphatase INPP5E coordinate initiation of ciliogenesis. Nature Communications. 2016;7( 26916822):10777. PubMed |
| Airik, Rannar; Schueler, Markus; Airik, Merlin; Cho, Jang; Ulanowicz, Kelsey A; Porath, Jonathan D; Hurd, Toby W; Bekker-Jensen, Simon; Schrøder, Jacob M; Andersen, Jens S; Hildebrandt, Friedhelm. SDCCAG8 Interacts with RAB Effector Proteins RABEP2 and ERC1 and Is Required for Hedgehog Signaling. Plos One. 11(5):e0156081. PubMed |
| Bowler, Mathew; Kong, Dong; Sun, Shufeng; Nanjundappa, Rashmi; Evans, Lauren; Farmer, Veronica; Holland, Andrew; Mahjoub, Moe R; Sui, Haixin; Loncarek, Jadranka. High-resolution characterization of centriole distal appendage morphology and dynamics by correlative STORM and electron microscopy. Nature Communications. 2019;10(1):993. PubMed |
| Evans, Lauren T; Anglen, Taylor; Scott, Phillip; Lukasik, Kimberly; Loncarek, Jadranka; Holland, Andrew J. ANKRD26 recruits PIDD1 to centriolar distal appendages to activate the PIDDosome following centrosome amplification. The Embo Journal. 2021;40(4):e105106. PubMed |
| Chen, Chuan; Xu, Qingwen; Zhang, Yuxia; Davies, Brian A; Huang, Yan; Katzmann, David J; Harris, Peter C; Hu, Jinghua; Ling, Kun. Ciliopathy protein HYLS1 coordinates the biogenesis and signaling of primary cilia by activating the ciliary lipid kinase PIPKIγ. Science Advances. 2021;7(26) PubMed |
| Gaudin, Noémie; Martin Gil, Paula; Boumendjel, Meriem; Ershov, Dmitry; Pioche-Durieu, Catherine; Bouix, Manon; Delobelle, Quentin; Maniscalco, Lucia; Phan, Than Bich Ngan; Heyer, Vincent; Reina-San-Martin, Bernardo; Azimzadeh, Juliette. Evolutionary conservation of centriole rotational asymmetry in the human centrosome. Elife. 2022;11( 35319462) PubMed |
| Failler, Marion; Gee, Heon Yung; Krug, Pauline; Joo, Kwangsic; Halbritter, Jan; Belkacem, Lilya; Filhol, Emilie; Porath, Jonathan D; Braun, Daniela A; Schueler, Markus; Frigo, Amandine; Alibeu, Olivier; Masson, Cécile; Brochard, Karine; Hurault de Ligny, Bruno; Novo, Robert; Pietrement, Christine; Kayserili, Hulya; Salomon, Rémi; Gubler, Marie-Claire; Otto, Edgar A; Antignac, Corinne; Kim, Joon; Benmerah, Alexandre; Hildebrandt, Friedhelm; Saunier, Sophie. Mutations of CEP83 cause infantile nephronophthisis and intellectual disability. American Journal Of Human Genetics. 2014;94(6):905-14. PubMed |
| Kong, Dong; Farmer, Veronica; Shukla, Anil; James, Jana; Gruskin, Richard; Kiriyama, Shigeo; Loncarek, Jadranka. Centriole maturation requires regulated Plk1 activity during two consecutive cell cycles. The Journal Of Cell Biology. 2014;206(7):855-65. PubMed |
| Vertii, Anastassiia; Zimmerman, Wendy; Ivshina, Maria; Doxsey, Stephen. Centrosome-intrinsic mechanisms modulate centrosome integrity during fever. Molecular Biology Of The Cell. 2015;26(19):3451-63. PubMed |
| Lo, Chien-Hui; Lin, I-Hsuan; Yang, T Tony; Huang, Yen-Chun; Tanos, Barbara E; Chou, Po-Chun; Chang, Chih-Wei; Tsay, Yeou-Guang; Liao, Jung-Chi; Wang, Won-Jing. Phosphorylation of CEP83 by TTBK2 is necessary for cilia initiation. The Journal Of Cell Biology. 2019;218(10):3489-3505. PubMed |
| Yan, Hao; Chen, Chuan; Chen, Huicheng; Hong, Hui; Huang, Yan; Ling, Kun; Hu, Jinghua; Wei, Qing. TALPID3 and ANKRD26 selectively orchestrate FBF1 localization and cilia gating. Nature Communications. 2020;11(1):2196. PubMed |
| Viol, Linda; Hata, Shoji; Pastor-Peidro, Ana; Neuner, Annett; Murke, Florian; Wuchter, Patrick; Ho, Anthony D; Giebel, Bernd; Pereira, Gislene. Nek2 kinase displaces distal appendages from the mother centriole prior to mitosis. The Journal Of Cell Biology. 2020;219(3) PubMed |