Anti CEP78 pAb (ATL-HPA048846)

Atlas Antibodies

Catalog No.: ATL-HPA048846-25

Protein Description: centrosomal protein 78kDa
Gene Name: CEP78
Alternative Gene Name: C9orf81, FLJ12643
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041491: 87%, ENSRNOG00000014041: 84%
Entrez Gene ID: 84131
Uniprot ID: Q5JTW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKGKATIRIGLATKKPVSSGRK
• Gene Sequence: ALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKGKATIRIGLATKKPVSSGRK
• Gene ID - Mouse: ENSMUSG00000041491
• Gene ID - Rat: ENSRNOG00000014041
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CEP78 pAb (ATL-HPA048846) – 1 Found

Namburi, Prasanthi; Ratnapriya, Rinki; Khateb, Samer; Lazar, Csilla H; Kinarty, Yael; Obolensky, Alexey; Erdinest, Inbar; Marks-Ohana, Devorah; Pras, Eran; Ben-Yosef, Tamar; Newman, Hadas; Gross, Menachem; Swaroop, Anand; Banin, Eyal; Sharon, Dror. Bi-allelic Truncating Mutations in CEP78, Encoding Centrosomal Protein 78, Cause Cone-Rod Degeneration with Sensorineural Hearing Loss. American Journal Of Human Genetics. 2016;99(3):777-784.