Anti CEP78 pAb (ATL-HPA048846)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048846-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CEP78
Alternative Gene Name: C9orf81, FLJ12643
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041491: 87%, ENSRNOG00000014041: 84%
Entrez Gene ID: 84131
Uniprot ID: Q5JTW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKGKATIRIGLATKKPVSSGRK |
Gene Sequence | ALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKGKATIRIGLATKKPVSSGRK |
Gene ID - Mouse | ENSMUSG00000041491 |
Gene ID - Rat | ENSRNOG00000014041 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEP78 pAb (ATL-HPA048846) | |
Datasheet | Anti CEP78 pAb (ATL-HPA048846) Datasheet (External Link) |
Vendor Page | Anti CEP78 pAb (ATL-HPA048846) at Atlas Antibodies |
Documents & Links for Anti CEP78 pAb (ATL-HPA048846) | |
Datasheet | Anti CEP78 pAb (ATL-HPA048846) Datasheet (External Link) |
Vendor Page | Anti CEP78 pAb (ATL-HPA048846) |
Citations for Anti CEP78 pAb (ATL-HPA048846) – 1 Found |
Namburi, Prasanthi; Ratnapriya, Rinki; Khateb, Samer; Lazar, Csilla H; Kinarty, Yael; Obolensky, Alexey; Erdinest, Inbar; Marks-Ohana, Devorah; Pras, Eran; Ben-Yosef, Tamar; Newman, Hadas; Gross, Menachem; Swaroop, Anand; Banin, Eyal; Sharon, Dror. Bi-allelic Truncating Mutations in CEP78, Encoding Centrosomal Protein 78, Cause Cone-Rod Degeneration with Sensorineural Hearing Loss. American Journal Of Human Genetics. 2016;99(3):777-784. PubMed |