Anti CEP78 pAb (ATL-HPA048846)

Atlas Antibodies

Catalog No.:
ATL-HPA048846-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 78kDa
Gene Name: CEP78
Alternative Gene Name: C9orf81, FLJ12643
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041491: 87%, ENSRNOG00000014041: 84%
Entrez Gene ID: 84131
Uniprot ID: Q5JTW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKGKATIRIGLATKKPVSSGRK
Gene Sequence ALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKGKATIRIGLATKKPVSSGRK
Gene ID - Mouse ENSMUSG00000041491
Gene ID - Rat ENSRNOG00000014041
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP78 pAb (ATL-HPA048846)
Datasheet Anti CEP78 pAb (ATL-HPA048846) Datasheet (External Link)
Vendor Page Anti CEP78 pAb (ATL-HPA048846) at Atlas Antibodies

Documents & Links for Anti CEP78 pAb (ATL-HPA048846)
Datasheet Anti CEP78 pAb (ATL-HPA048846) Datasheet (External Link)
Vendor Page Anti CEP78 pAb (ATL-HPA048846)
Citations for Anti CEP78 pAb (ATL-HPA048846) – 1 Found
Namburi, Prasanthi; Ratnapriya, Rinki; Khateb, Samer; Lazar, Csilla H; Kinarty, Yael; Obolensky, Alexey; Erdinest, Inbar; Marks-Ohana, Devorah; Pras, Eran; Ben-Yosef, Tamar; Newman, Hadas; Gross, Menachem; Swaroop, Anand; Banin, Eyal; Sharon, Dror. Bi-allelic Truncating Mutations in CEP78, Encoding Centrosomal Protein 78, Cause Cone-Rod Degeneration with Sensorineural Hearing Loss. American Journal Of Human Genetics. 2016;99(3):777-784.  PubMed