Anti CEP76 pAb (ATL-HPA039395)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039395-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CEP76
Alternative Gene Name: C18orf9, FLJ12542, HsT1705
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073542: 97%, ENSRNOG00000021918: 97%
Entrez Gene ID: 79959
Uniprot ID: Q8TAP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAIKSVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWED |
Gene Sequence | PTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAIKSVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWED |
Gene ID - Mouse | ENSMUSG00000073542 |
Gene ID - Rat | ENSRNOG00000021918 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEP76 pAb (ATL-HPA039395) | |
Datasheet | Anti CEP76 pAb (ATL-HPA039395) Datasheet (External Link) |
Vendor Page | Anti CEP76 pAb (ATL-HPA039395) at Atlas Antibodies |
Documents & Links for Anti CEP76 pAb (ATL-HPA039395) | |
Datasheet | Anti CEP76 pAb (ATL-HPA039395) Datasheet (External Link) |
Vendor Page | Anti CEP76 pAb (ATL-HPA039395) |