Anti CEP76 pAb (ATL-HPA039395)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039395-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CEP76
Alternative Gene Name: C18orf9, FLJ12542, HsT1705
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073542: 97%, ENSRNOG00000021918: 97%
Entrez Gene ID: 79959
Uniprot ID: Q8TAP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAIKSVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWED |
| Gene Sequence | PTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAIKSVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWED |
| Gene ID - Mouse | ENSMUSG00000073542 |
| Gene ID - Rat | ENSRNOG00000021918 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEP76 pAb (ATL-HPA039395) | |
| Datasheet | Anti CEP76 pAb (ATL-HPA039395) Datasheet (External Link) |
| Vendor Page | Anti CEP76 pAb (ATL-HPA039395) at Atlas Antibodies |
| Documents & Links for Anti CEP76 pAb (ATL-HPA039395) | |
| Datasheet | Anti CEP76 pAb (ATL-HPA039395) Datasheet (External Link) |
| Vendor Page | Anti CEP76 pAb (ATL-HPA039395) |