Anti CEP76 pAb (ATL-HPA039395)

Atlas Antibodies

Catalog No.: ATL-HPA039395-25

Protein Description: centrosomal protein 76kDa
Gene Name: CEP76
Alternative Gene Name: C18orf9, FLJ12542, HsT1705
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073542: 97%, ENSRNOG00000021918: 97%
Entrez Gene ID: 79959
Uniprot ID: Q8TAP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAIKSVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWED
• Gene Sequence: PTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAIKSVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWED
• Gene ID - Mouse: ENSMUSG00000073542
• Gene ID - Rat: ENSRNOG00000021918
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.