Anti CEP72 pAb (ATL-HPA074879)

Atlas Antibodies

Catalog No.:
ATL-HPA074879-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 72kDa
Gene Name: CEP72
Alternative Gene Name: FLJ10565, KIAA1519
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021572: 84%, ENSRNOG00000015465: 84%
Entrez Gene ID: 55722
Uniprot ID: Q9P209
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVKRLCGEIVELKQHLEHYDKIQELTQMLQESHSSLVSTNEHLLQELSQVRAQHRAEVEQMHWSYQELKKTMALF
Gene Sequence SVKRLCGEIVELKQHLEHYDKIQELTQMLQESHSSLVSTNEHLLQELSQVRAQHRAEVEQMHWSYQELKKTMALF
Gene ID - Mouse ENSMUSG00000021572
Gene ID - Rat ENSRNOG00000015465
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP72 pAb (ATL-HPA074879)
Datasheet Anti CEP72 pAb (ATL-HPA074879) Datasheet (External Link)
Vendor Page Anti CEP72 pAb (ATL-HPA074879) at Atlas Antibodies

Documents & Links for Anti CEP72 pAb (ATL-HPA074879)
Datasheet Anti CEP72 pAb (ATL-HPA074879) Datasheet (External Link)
Vendor Page Anti CEP72 pAb (ATL-HPA074879)