Anti CEP72 pAb (ATL-HPA058235)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058235-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CEP72
Alternative Gene Name: FLJ10565, KIAA1519
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021572: 49%, ENSRNOG00000015465: 48%
Entrez Gene ID: 55722
Uniprot ID: Q9P209
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YQCGDSGKQGRETRRSSCRGCCLEKMPWSQLCGELPPLYGAEPEASRAPRPHTYFTPHPDSMDTEDSASSQKLDLSGEMVPGPLPAPGKCRKRRMP |
Gene Sequence | YQCGDSGKQGRETRRSSCRGCCLEKMPWSQLCGELPPLYGAEPEASRAPRPHTYFTPHPDSMDTEDSASSQKLDLSGEMVPGPLPAPGKCRKRRMP |
Gene ID - Mouse | ENSMUSG00000021572 |
Gene ID - Rat | ENSRNOG00000015465 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEP72 pAb (ATL-HPA058235) | |
Datasheet | Anti CEP72 pAb (ATL-HPA058235) Datasheet (External Link) |
Vendor Page | Anti CEP72 pAb (ATL-HPA058235) at Atlas Antibodies |
Documents & Links for Anti CEP72 pAb (ATL-HPA058235) | |
Datasheet | Anti CEP72 pAb (ATL-HPA058235) Datasheet (External Link) |
Vendor Page | Anti CEP72 pAb (ATL-HPA058235) |