Anti CEP70 pAb (ATL-HPA036941 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036941-25

• 
• 

Protein Description: centrosomal protein 70kDa
Gene Name: CEP70
Alternative Gene Name: BITE, FLJ13036
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056267: 72%, ENSRNOG00000022845: 67%
Entrez Gene ID: 80321
Uniprot ID: Q8NHQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTEQEETIASLQMEVCRLKKEEEDRIVTQNRVFAYLCKRVPHTVLDRQLLCLIDYYESKIRKIHTQRQYKEDESQSEEENDYRNLDA
• Gene Sequence: RTEQEETIASLQMEVCRLKKEEEDRIVTQNRVFAYLCKRVPHTVLDRQLLCLIDYYESKIRKIHTQRQYKEDESQSEEENDYRNLDA
• Gene ID - Mouse: ENSMUSG00000056267
• Gene ID - Rat: ENSRNOG00000022845
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.