Anti CEP63 pAb (ATL-HPA058154)

Atlas Antibodies

Catalog No.:
ATL-HPA058154-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 63kDa
Gene Name: CEP63
Alternative Gene Name: FLJ13386
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032534: 85%, ENSRNOG00000008410: 83%
Entrez Gene ID: 80254
Uniprot ID: Q96MT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKRMEAHNNEYKAEIKKLKEQILQGEQSYSSALEGMKMEISHLTQELHQRDITIASTKGSSSDMEKRLRAEMQKAEDKAVEHKEILDQLESL
Gene Sequence LKRMEAHNNEYKAEIKKLKEQILQGEQSYSSALEGMKMEISHLTQELHQRDITIASTKGSSSDMEKRLRAEMQKAEDKAVEHKEILDQLESL
Gene ID - Mouse ENSMUSG00000032534
Gene ID - Rat ENSRNOG00000008410
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP63 pAb (ATL-HPA058154)
Datasheet Anti CEP63 pAb (ATL-HPA058154) Datasheet (External Link)
Vendor Page Anti CEP63 pAb (ATL-HPA058154) at Atlas Antibodies

Documents & Links for Anti CEP63 pAb (ATL-HPA058154)
Datasheet Anti CEP63 pAb (ATL-HPA058154) Datasheet (External Link)
Vendor Page Anti CEP63 pAb (ATL-HPA058154)