Anti CEP57L1 pAb (ATL-HPA040378)

Atlas Antibodies

Catalog No.:
ATL-HPA040378-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 57kDa-like 1
Gene Name: CEP57L1
Alternative Gene Name: bA487F23.2, C6orf182, MGC21731
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019813: 44%, ENSRNOG00000000303: 43%
Entrez Gene ID: 285753
Uniprot ID: Q8IYX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKKTKCIKRRPPWQICSKFGALPFVAEKMRQHRDPHILQKPFNVTETRCLPKPSRTTSWCKAIPPDSEKSISICDNLSELLMAMQDELDQMSMEHQE
Gene Sequence SKKTKCIKRRPPWQICSKFGALPFVAEKMRQHRDPHILQKPFNVTETRCLPKPSRTTSWCKAIPPDSEKSISICDNLSELLMAMQDELDQMSMEHQE
Gene ID - Mouse ENSMUSG00000019813
Gene ID - Rat ENSRNOG00000000303
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP57L1 pAb (ATL-HPA040378)
Datasheet Anti CEP57L1 pAb (ATL-HPA040378) Datasheet (External Link)
Vendor Page Anti CEP57L1 pAb (ATL-HPA040378) at Atlas Antibodies

Documents & Links for Anti CEP57L1 pAb (ATL-HPA040378)
Datasheet Anti CEP57L1 pAb (ATL-HPA040378) Datasheet (External Link)
Vendor Page Anti CEP57L1 pAb (ATL-HPA040378)