Anti CEP57L1 pAb (ATL-HPA040378)
Atlas Antibodies
- SKU:
- ATL-HPA040378-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CEP57L1
Alternative Gene Name: bA487F23.2, C6orf182, MGC21731
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019813: 44%, ENSRNOG00000000303: 43%
Entrez Gene ID: 285753
Uniprot ID: Q8IYX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SKKTKCIKRRPPWQICSKFGALPFVAEKMRQHRDPHILQKPFNVTETRCLPKPSRTTSWCKAIPPDSEKSISICDNLSELLMAMQDELDQMSMEHQE |
Gene Sequence | SKKTKCIKRRPPWQICSKFGALPFVAEKMRQHRDPHILQKPFNVTETRCLPKPSRTTSWCKAIPPDSEKSISICDNLSELLMAMQDELDQMSMEHQE |
Gene ID - Mouse | ENSMUSG00000019813 |
Gene ID - Rat | ENSRNOG00000000303 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEP57L1 pAb (ATL-HPA040378) | |
Datasheet | Anti CEP57L1 pAb (ATL-HPA040378) Datasheet (External Link) |
Vendor Page | Anti CEP57L1 pAb (ATL-HPA040378) at Atlas Antibodies |
Documents & Links for Anti CEP57L1 pAb (ATL-HPA040378) | |
Datasheet | Anti CEP57L1 pAb (ATL-HPA040378) Datasheet (External Link) |
Vendor Page | Anti CEP57L1 pAb (ATL-HPA040378) |