Anti CEP57L1 pAb (ATL-HPA040378)

Atlas Antibodies

SKU: ATL-HPA040378-25

• 
• 
• 

Protein Description: centrosomal protein 57kDa-like 1
Gene Name: CEP57L1
Alternative Gene Name: bA487F23.2, C6orf182, MGC21731
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019813: 44%, ENSRNOG00000000303: 43%
Entrez Gene ID: 285753
Uniprot ID: Q8IYX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKKTKCIKRRPPWQICSKFGALPFVAEKMRQHRDPHILQKPFNVTETRCLPKPSRTTSWCKAIPPDSEKSISICDNLSELLMAMQDELDQMSMEHQE
• Gene Sequence: SKKTKCIKRRPPWQICSKFGALPFVAEKMRQHRDPHILQKPFNVTETRCLPKPSRTTSWCKAIPPDSEKSISICDNLSELLMAMQDELDQMSMEHQE
• Gene ID - Mouse: ENSMUSG00000019813
• Gene ID - Rat: ENSRNOG00000000303
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.