Anti CEP57 pAb (ATL-HPA018315)

Atlas Antibodies

SKU: ATL-HPA018315-25

• 
• 
• 

Protein Description: centrosomal protein 57kDa
Gene Name: CEP57
Alternative Gene Name: KIAA0092, Translokin, TSP57
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031922: 95%, ENSRNOG00000006792: 94%
Entrez Gene ID: 9702
Uniprot ID: Q86XR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKR
• Gene Sequence: SKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKR
• Gene ID - Mouse: ENSMUSG00000031922
• Gene ID - Rat: ENSRNOG00000006792
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.