Anti CEP55 pAb (ATL-HPA023430)

Atlas Antibodies

Catalog No.:
ATL-HPA023430-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 55kDa
Gene Name: CEP55
Alternative Gene Name: C10orf3, CT111, FLJ10540
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024989: 71%, ENSRNOG00000016377: 77%
Entrez Gene ID: 55165
Uniprot ID: Q53EZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLVTFQGETENREKVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCS
Gene Sequence PLVTFQGETENREKVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCS
Gene ID - Mouse ENSMUSG00000024989
Gene ID - Rat ENSRNOG00000016377
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP55 pAb (ATL-HPA023430)
Datasheet Anti CEP55 pAb (ATL-HPA023430) Datasheet (External Link)
Vendor Page Anti CEP55 pAb (ATL-HPA023430) at Atlas Antibodies

Documents & Links for Anti CEP55 pAb (ATL-HPA023430)
Datasheet Anti CEP55 pAb (ATL-HPA023430) Datasheet (External Link)
Vendor Page Anti CEP55 pAb (ATL-HPA023430)
Citations for Anti CEP55 pAb (ATL-HPA023430) – 1 Found
Wang, Linbang; Liu, Wei; Liu, Jingkun; Wang, Yuanyuan; Tai, Jiaojiao; Yin, Xuedong; Tan, Jinxiang. Identification of Immune-Related Therapeutically Relevant Biomarkers in Breast Cancer and Breast Cancer Stem Cells by Transcriptome-Wide Analysis: A Clinical Prospective Study. Frontiers In Oncology. 10( 33718103):554138.  PubMed