Anti CEP55 pAb (ATL-HPA023430)

Atlas Antibodies

SKU: ATL-HPA023430-25

• 
• 
• 

Protein Description: centrosomal protein 55kDa
Gene Name: CEP55
Alternative Gene Name: C10orf3, CT111, FLJ10540
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024989: 71%, ENSRNOG00000016377: 77%
Entrez Gene ID: 55165
Uniprot ID: Q53EZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLVTFQGETENREKVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCS
• Gene Sequence: PLVTFQGETENREKVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCS
• Gene ID - Mouse: ENSMUSG00000024989
• Gene ID - Rat: ENSRNOG00000016377
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CEP55 pAb (ATL-HPA023430) – 1 Found

Wang, Linbang; Liu, Wei; Liu, Jingkun; Wang, Yuanyuan; Tai, Jiaojiao; Yin, Xuedong; Tan, Jinxiang. Identification of Immune-Related Therapeutically Relevant Biomarkers in Breast Cancer and Breast Cancer Stem Cells by Transcriptome-Wide Analysis: A Clinical Prospective Study. Frontiers In Oncology. 10( 33718103):554138.