Anti CEP44 pAb (ATL-HPA041835 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041835-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 44kDa
Gene Name: CEP44
Alternative Gene Name: KIAA1712
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038215: 71%, ENSRNOG00000010566: 73%
Entrez Gene ID: 80817
Uniprot ID: Q9C0F1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKVPEIKAEQQDVNVNPEITALQTMLAECQENLKKLTSIEKRLDCLEQKMKGKVMVDENTWTNLLSRVTLLETEMLLSK
Gene Sequence VKVPEIKAEQQDVNVNPEITALQTMLAECQENLKKLTSIEKRLDCLEQKMKGKVMVDENTWTNLLSRVTLLETEMLLSK
Gene ID - Mouse ENSMUSG00000038215
Gene ID - Rat ENSRNOG00000010566
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP44 pAb (ATL-HPA041835 w/enhanced validation)
Datasheet Anti CEP44 pAb (ATL-HPA041835 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CEP44 pAb (ATL-HPA041835 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CEP44 pAb (ATL-HPA041835 w/enhanced validation)
Datasheet Anti CEP44 pAb (ATL-HPA041835 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CEP44 pAb (ATL-HPA041835 w/enhanced validation)