Anti CEP44 pAb (ATL-HPA041835 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA041835-25

• 
• 

Protein Description: centrosomal protein 44kDa
Gene Name: CEP44
Alternative Gene Name: KIAA1712
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038215: 71%, ENSRNOG00000010566: 73%
Entrez Gene ID: 80817
Uniprot ID: Q9C0F1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VKVPEIKAEQQDVNVNPEITALQTMLAECQENLKKLTSIEKRLDCLEQKMKGKVMVDENTWTNLLSRVTLLETEMLLSK
• Gene Sequence: VKVPEIKAEQQDVNVNPEITALQTMLAECQENLKKLTSIEKRLDCLEQKMKGKVMVDENTWTNLLSRVTLLETEMLLSK
• Gene ID - Mouse: ENSMUSG00000038215
• Gene ID - Rat: ENSRNOG00000010566
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.