Anti CEP350 pAb (ATL-HPA030845)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030845-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CEP350
Alternative Gene Name: CAP350, KIAA0480
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033671: 81%, ENSRNOG00000003882: 83%
Entrez Gene ID: 9857
Uniprot ID: Q5VT06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QVVQSQREVTEVLQEATCKIAAQQSETARLTTDAARQICEMAELTRTHISDAVVASGAPLAILYDHQRQHLPDFVKQLRTRTETDRKSPSVSLSQ |
Gene Sequence | QVVQSQREVTEVLQEATCKIAAQQSETARLTTDAARQICEMAELTRTHISDAVVASGAPLAILYDHQRQHLPDFVKQLRTRTETDRKSPSVSLSQ |
Gene ID - Mouse | ENSMUSG00000033671 |
Gene ID - Rat | ENSRNOG00000003882 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEP350 pAb (ATL-HPA030845) | |
Datasheet | Anti CEP350 pAb (ATL-HPA030845) Datasheet (External Link) |
Vendor Page | Anti CEP350 pAb (ATL-HPA030845) at Atlas Antibodies |
Documents & Links for Anti CEP350 pAb (ATL-HPA030845) | |
Datasheet | Anti CEP350 pAb (ATL-HPA030845) Datasheet (External Link) |
Vendor Page | Anti CEP350 pAb (ATL-HPA030845) |
Citations for Anti CEP350 pAb (ATL-HPA030845) – 1 Found |
Mahen, Robert. Stable centrosomal roots disentangle to allow interphase centriole independence. Plos Biology. 2018;16(4):e2003998. PubMed |