Anti CEP350 pAb (ATL-HPA030845)

Atlas Antibodies

Catalog No.: ATL-HPA030845-25

Protein Description: centrosomal protein 350kDa
Gene Name: CEP350
Alternative Gene Name: CAP350, KIAA0480
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033671: 81%, ENSRNOG00000003882: 83%
Entrez Gene ID: 9857
Uniprot ID: Q5VT06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVVQSQREVTEVLQEATCKIAAQQSETARLTTDAARQICEMAELTRTHISDAVVASGAPLAILYDHQRQHLPDFVKQLRTRTETDRKSPSVSLSQ
• Gene Sequence: QVVQSQREVTEVLQEATCKIAAQQSETARLTTDAARQICEMAELTRTHISDAVVASGAPLAILYDHQRQHLPDFVKQLRTRTETDRKSPSVSLSQ
• Gene ID - Mouse: ENSMUSG00000033671
• Gene ID - Rat: ENSRNOG00000003882
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CEP350 pAb (ATL-HPA030845) – 1 Found

Mahen, Robert. Stable centrosomal roots disentangle to allow interphase centriole independence. Plos Biology. 2018;16(4):e2003998.