Anti CEP295NL pAb (ATL-HPA025717)

Atlas Antibodies

SKU:
ATL-HPA025717-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in subsets of seminiferous duct cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CEP295 N-terminal like
Gene Name: CEP295NL
Alternative Gene Name: DDC8, KIAA1731NL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026380: 25%, ENSRNOG00000002414: 25%
Entrez Gene ID: 100653515
Uniprot ID: Q96MC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CSGWSSSVIWRHTQFAVERCGFCGSSGPGAPLEPSTLGSKHLPWEAVSAGFADRNRNMDGAMWLSLCPDNEDLLWRKKHKLLQAR
Gene Sequence CSGWSSSVIWRHTQFAVERCGFCGSSGPGAPLEPSTLGSKHLPWEAVSAGFADRNRNMDGAMWLSLCPDNEDLLWRKKHKLLQAR
Gene ID - Mouse ENSMUSG00000026380
Gene ID - Rat ENSRNOG00000002414
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CEP295NL pAb (ATL-HPA025717)
Datasheet Anti CEP295NL pAb (ATL-HPA025717) Datasheet (External Link)
Vendor Page Anti CEP295NL pAb (ATL-HPA025717) at Atlas Antibodies

Documents & Links for Anti CEP295NL pAb (ATL-HPA025717)
Datasheet Anti CEP295NL pAb (ATL-HPA025717) Datasheet (External Link)
Vendor Page Anti CEP295NL pAb (ATL-HPA025717)