Anti CEP295NL pAb (ATL-HPA023609)

Atlas Antibodies

SKU:
ATL-HPA023609-25
  • Immunohistochemical staining of human tonsil shows moderate positivity in reaction center cells while cells outside the reaction center were strongly positive.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CEP295 N-terminal like
Gene Name: CEP295NL
Alternative Gene Name: DDC8, KIAA1731NL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000076433: 34%, ENSRNOG00000010712: 27%
Entrez Gene ID: 100653515
Uniprot ID: Q96MC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPRGKKMADPEMLPAGEPRSPAEEEAQQAASKTDLKTFMGKAQNQKYQGTVKPTFRNGSQTLSPEAGIFINKEDSLLYSTESGQETPKLGTLA
Gene Sequence TPRGKKMADPEMLPAGEPRSPAEEEAQQAASKTDLKTFMGKAQNQKYQGTVKPTFRNGSQTLSPEAGIFINKEDSLLYSTESGQETPKLGTLA
Gene ID - Mouse ENSMUSG00000076433
Gene ID - Rat ENSRNOG00000010712
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CEP295NL pAb (ATL-HPA023609)
Datasheet Anti CEP295NL pAb (ATL-HPA023609) Datasheet (External Link)
Vendor Page Anti CEP295NL pAb (ATL-HPA023609) at Atlas Antibodies

Documents & Links for Anti CEP295NL pAb (ATL-HPA023609)
Datasheet Anti CEP295NL pAb (ATL-HPA023609) Datasheet (External Link)
Vendor Page Anti CEP295NL pAb (ATL-HPA023609)