Anti CEP295 pAb (ATL-HPA038596)

Atlas Antibodies

Catalog No.:
ATL-HPA038596-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 295kDa
Gene Name: CEP295
Alternative Gene Name: KIAA1731
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046111: 66%, ENSRNOG00000010999: 56%
Entrez Gene ID: 85459
Uniprot ID: Q9C0D2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRVSISREQSFFGSPLAHDPFSCLQLVGQENVCGDDYDEAVKLKESVVENHAVLSYAVEEEHAYLGPTVKPDDKAKTLSYEPLSSATVSTGSLLSYENTDLS
Gene Sequence LRVSISREQSFFGSPLAHDPFSCLQLVGQENVCGDDYDEAVKLKESVVENHAVLSYAVEEEHAYLGPTVKPDDKAKTLSYEPLSSATVSTGSLLSYENTDLS
Gene ID - Mouse ENSMUSG00000046111
Gene ID - Rat ENSRNOG00000010999
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP295 pAb (ATL-HPA038596)
Datasheet Anti CEP295 pAb (ATL-HPA038596) Datasheet (External Link)
Vendor Page Anti CEP295 pAb (ATL-HPA038596) at Atlas Antibodies

Documents & Links for Anti CEP295 pAb (ATL-HPA038596)
Datasheet Anti CEP295 pAb (ATL-HPA038596) Datasheet (External Link)
Vendor Page Anti CEP295 pAb (ATL-HPA038596)
Citations for Anti CEP295 pAb (ATL-HPA038596) – 2 Found
Ito, Kei K; Watanabe, Koki; Ishida, Haruki; Matsuhashi, Kyohei; Chinen, Takumi; Hata, Shoji; Kitagawa, Daiju. Cep57 and Cep57L1 maintain centriole engagement in interphase to ensure centriole duplication cycle. The Journal Of Cell Biology. 2021;220(3)  PubMed
Tsuchiya, Yuki; Yoshiba, Satoko; Gupta, Akshari; Watanabe, Koki; Kitagawa, Daiju. Cep295 is a conserved scaffold protein required for generation of a bona fide mother centriole. Nature Communications. 2016;7( 27562453):12567.  PubMed