Anti CEP295 pAb (ATL-HPA038596)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038596-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CEP295
Alternative Gene Name: KIAA1731
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046111: 66%, ENSRNOG00000010999: 56%
Entrez Gene ID: 85459
Uniprot ID: Q9C0D2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LRVSISREQSFFGSPLAHDPFSCLQLVGQENVCGDDYDEAVKLKESVVENHAVLSYAVEEEHAYLGPTVKPDDKAKTLSYEPLSSATVSTGSLLSYENTDLS |
Gene Sequence | LRVSISREQSFFGSPLAHDPFSCLQLVGQENVCGDDYDEAVKLKESVVENHAVLSYAVEEEHAYLGPTVKPDDKAKTLSYEPLSSATVSTGSLLSYENTDLS |
Gene ID - Mouse | ENSMUSG00000046111 |
Gene ID - Rat | ENSRNOG00000010999 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEP295 pAb (ATL-HPA038596) | |
Datasheet | Anti CEP295 pAb (ATL-HPA038596) Datasheet (External Link) |
Vendor Page | Anti CEP295 pAb (ATL-HPA038596) at Atlas Antibodies |
Documents & Links for Anti CEP295 pAb (ATL-HPA038596) | |
Datasheet | Anti CEP295 pAb (ATL-HPA038596) Datasheet (External Link) |
Vendor Page | Anti CEP295 pAb (ATL-HPA038596) |
Citations for Anti CEP295 pAb (ATL-HPA038596) – 2 Found |
Ito, Kei K; Watanabe, Koki; Ishida, Haruki; Matsuhashi, Kyohei; Chinen, Takumi; Hata, Shoji; Kitagawa, Daiju. Cep57 and Cep57L1 maintain centriole engagement in interphase to ensure centriole duplication cycle. The Journal Of Cell Biology. 2021;220(3) PubMed |
Tsuchiya, Yuki; Yoshiba, Satoko; Gupta, Akshari; Watanabe, Koki; Kitagawa, Daiju. Cep295 is a conserved scaffold protein required for generation of a bona fide mother centriole. Nature Communications. 2016;7( 27562453):12567. PubMed |