Anti CEP290 pAb (ATL-HPA064397)

Atlas Antibodies

Catalog No.:
ATL-HPA064397-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 290kDa
Gene Name: CEP290
Alternative Gene Name: 3H11Ag, BBS14, CT87, FLJ13615, JBTS5, KIAA0373, LCA10, MKS4, NPHP6, POC3, rd16, SLSN6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019971: 92%, ENSRNOG00000056458: 93%
Entrez Gene ID: 80184
Uniprot ID: O15078
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IIPSLERLVNAIESKNAEGIFDASLHLKAQVDQLTGRNEELRQELRESRKEAINYSQQLAKANLKIDHLEKETSLLRQSEGSNVVFKGIDLPDGIAPSSASII
Gene Sequence IIPSLERLVNAIESKNAEGIFDASLHLKAQVDQLTGRNEELRQELRESRKEAINYSQQLAKANLKIDHLEKETSLLRQSEGSNVVFKGIDLPDGIAPSSASII
Gene ID - Mouse ENSMUSG00000019971
Gene ID - Rat ENSRNOG00000056458
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP290 pAb (ATL-HPA064397)
Datasheet Anti CEP290 pAb (ATL-HPA064397) Datasheet (External Link)
Vendor Page Anti CEP290 pAb (ATL-HPA064397) at Atlas Antibodies

Documents & Links for Anti CEP290 pAb (ATL-HPA064397)
Datasheet Anti CEP290 pAb (ATL-HPA064397) Datasheet (External Link)
Vendor Page Anti CEP290 pAb (ATL-HPA064397)