Anti CEP192 pAb (ATL-HPA040503 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA040503-25

• 
• 

Protein Description: centrosomal protein 192kDa
Gene Name: CEP192
Alternative Gene Name: FLJ10352, KIAA1569, PPP1R62
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024542: 71%, ENSRNOG00000042879: 74%
Entrez Gene ID: 55125
Uniprot ID: Q8TEP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FVLKERTQENVTLIYNPSDRGINNKTATELSTVYLFGGDEISRQQYRRALLHKPEMIKQILPEHSVLQNINFVEAFQDELLVTEVYD
• Gene Sequence: FVLKERTQENVTLIYNPSDRGINNKTATELSTVYLFGGDEISRQQYRRALLHKPEMIKQILPEHSVLQNINFVEAFQDELLVTEVYD
• Gene ID - Mouse: ENSMUSG00000024542
• Gene ID - Rat: ENSRNOG00000042879
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.