Anti CEP192 pAb (ATL-HPA039392)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039392-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CEP192
Alternative Gene Name: FLJ10352, KIAA1569, PPP1R62
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024542: 80%, ENSRNOG00000042879: 82%
Entrez Gene ID: 55125
Uniprot ID: Q8TEP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KGVDESGDVFRATYAAFRCSPISGLLESHGIQKVSITFLPRGRGDYAQFWDVECHPLKEPHMKHTLRFQLSGQSIEAENEPENACLSTDSLI |
Gene Sequence | KGVDESGDVFRATYAAFRCSPISGLLESHGIQKVSITFLPRGRGDYAQFWDVECHPLKEPHMKHTLRFQLSGQSIEAENEPENACLSTDSLI |
Gene ID - Mouse | ENSMUSG00000024542 |
Gene ID - Rat | ENSRNOG00000042879 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEP192 pAb (ATL-HPA039392) | |
Datasheet | Anti CEP192 pAb (ATL-HPA039392) Datasheet (External Link) |
Vendor Page | Anti CEP192 pAb (ATL-HPA039392) at Atlas Antibodies |
Documents & Links for Anti CEP192 pAb (ATL-HPA039392) | |
Datasheet | Anti CEP192 pAb (ATL-HPA039392) Datasheet (External Link) |
Vendor Page | Anti CEP192 pAb (ATL-HPA039392) |