Anti CEP192 pAb (ATL-HPA039392)

Atlas Antibodies

Catalog No.:
ATL-HPA039392-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 192kDa
Gene Name: CEP192
Alternative Gene Name: FLJ10352, KIAA1569, PPP1R62
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024542: 80%, ENSRNOG00000042879: 82%
Entrez Gene ID: 55125
Uniprot ID: Q8TEP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGVDESGDVFRATYAAFRCSPISGLLESHGIQKVSITFLPRGRGDYAQFWDVECHPLKEPHMKHTLRFQLSGQSIEAENEPENACLSTDSLI
Gene Sequence KGVDESGDVFRATYAAFRCSPISGLLESHGIQKVSITFLPRGRGDYAQFWDVECHPLKEPHMKHTLRFQLSGQSIEAENEPENACLSTDSLI
Gene ID - Mouse ENSMUSG00000024542
Gene ID - Rat ENSRNOG00000042879
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP192 pAb (ATL-HPA039392)
Datasheet Anti CEP192 pAb (ATL-HPA039392) Datasheet (External Link)
Vendor Page Anti CEP192 pAb (ATL-HPA039392) at Atlas Antibodies

Documents & Links for Anti CEP192 pAb (ATL-HPA039392)
Datasheet Anti CEP192 pAb (ATL-HPA039392) Datasheet (External Link)
Vendor Page Anti CEP192 pAb (ATL-HPA039392)