Anti CEP19 pAb (ATL-HPA047614 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA047614-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 19kDa
Gene Name: CEP19
Alternative Gene Name: C3orf34, MGC14126
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035790: 84%, ENSRNOG00000024924: 85%
Entrez Gene ID: 84984
Uniprot ID: Q96LK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFS
Gene Sequence MCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFS
Gene ID - Mouse ENSMUSG00000035790
Gene ID - Rat ENSRNOG00000024924
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP19 pAb (ATL-HPA047614 w/enhanced validation)
Datasheet Anti CEP19 pAb (ATL-HPA047614 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CEP19 pAb (ATL-HPA047614 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CEP19 pAb (ATL-HPA047614 w/enhanced validation)
Datasheet Anti CEP19 pAb (ATL-HPA047614 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CEP19 pAb (ATL-HPA047614 w/enhanced validation)
Citations for Anti CEP19 pAb (ATL-HPA047614 w/enhanced validation) – 1 Found
Huang, Kang-Bo; Guo, Sheng-Jie; Li, Yong-Hong; Zhang, Xin-Ke; Chen, Dong; Spiess, Philippe E; Li, Zai-Shang; Deng, Chuang-Zhong; Chen, Jie-Ping; Zhou, Qiang-Hua; Hu, Zheng; Ma, Xin; Jin, Jie-Tian; Cao, Yun; Luo, Jun-Hang; Wang, Xiao-Bin; Zhou, Fang-Jian; Liu, Ran-Yi; Han, Hui. Genome-Wide Profiling Reveals HPV Integration Pattern and Activated Carcinogenic Pathways in Penile Squamous Cell Carcinoma. Cancers. 2021;13(23)  PubMed