Anti CEP170 pAb (ATL-HPA045787)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045787-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CEP170
Alternative Gene Name: FAM68A, KAB, KIAA0470
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057335: 76%, ENSRNOG00000004127: 75%
Entrez Gene ID: 9859
Uniprot ID: Q5SW79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SQWASLAANHTRHDQEERIMEFSAPLPLENETEISESGMTVRSTGSATSLASQGERRRRTLPQLPNEEKSLESHRAKVVTQRSEIGEKQDTELQEKETP |
| Gene Sequence | SQWASLAANHTRHDQEERIMEFSAPLPLENETEISESGMTVRSTGSATSLASQGERRRRTLPQLPNEEKSLESHRAKVVTQRSEIGEKQDTELQEKETP |
| Gene ID - Mouse | ENSMUSG00000057335 |
| Gene ID - Rat | ENSRNOG00000004127 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEP170 pAb (ATL-HPA045787) | |
| Datasheet | Anti CEP170 pAb (ATL-HPA045787) Datasheet (External Link) |
| Vendor Page | Anti CEP170 pAb (ATL-HPA045787) at Atlas Antibodies |
| Documents & Links for Anti CEP170 pAb (ATL-HPA045787) | |
| Datasheet | Anti CEP170 pAb (ATL-HPA045787) Datasheet (External Link) |
| Vendor Page | Anti CEP170 pAb (ATL-HPA045787) |