Anti CEP170 pAb (ATL-HPA045787)

Atlas Antibodies

Catalog No.:
ATL-HPA045787-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 170kDa
Gene Name: CEP170
Alternative Gene Name: FAM68A, KAB, KIAA0470
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057335: 76%, ENSRNOG00000004127: 75%
Entrez Gene ID: 9859
Uniprot ID: Q5SW79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQWASLAANHTRHDQEERIMEFSAPLPLENETEISESGMTVRSTGSATSLASQGERRRRTLPQLPNEEKSLESHRAKVVTQRSEIGEKQDTELQEKETP
Gene Sequence SQWASLAANHTRHDQEERIMEFSAPLPLENETEISESGMTVRSTGSATSLASQGERRRRTLPQLPNEEKSLESHRAKVVTQRSEIGEKQDTELQEKETP
Gene ID - Mouse ENSMUSG00000057335
Gene ID - Rat ENSRNOG00000004127
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP170 pAb (ATL-HPA045787)
Datasheet Anti CEP170 pAb (ATL-HPA045787) Datasheet (External Link)
Vendor Page Anti CEP170 pAb (ATL-HPA045787) at Atlas Antibodies

Documents & Links for Anti CEP170 pAb (ATL-HPA045787)
Datasheet Anti CEP170 pAb (ATL-HPA045787) Datasheet (External Link)
Vendor Page Anti CEP170 pAb (ATL-HPA045787)