Anti CEP164 pAb (ATL-HPA037606)

Atlas Antibodies

Catalog No.:
ATL-HPA037606-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 164kDa
Gene Name: CEP164
Alternative Gene Name: KIAA1052, NPHP15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043987: 54%, ENSRNOG00000029826: 51%
Entrez Gene ID: 22897
Uniprot ID: Q9UPV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DASQELEISEHMKEPQLSDSIASDPKSFHGLDFGFRSRISEHLLDVDVLSPVLGGACRQAQQPLGIEDKDDSQSSQDELQSKQSKGLEERLSPPLPHE
Gene Sequence DASQELEISEHMKEPQLSDSIASDPKSFHGLDFGFRSRISEHLLDVDVLSPVLGGACRQAQQPLGIEDKDDSQSSQDELQSKQSKGLEERLSPPLPHE
Gene ID - Mouse ENSMUSG00000043987
Gene ID - Rat ENSRNOG00000029826
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP164 pAb (ATL-HPA037606)
Datasheet Anti CEP164 pAb (ATL-HPA037606) Datasheet (External Link)
Vendor Page Anti CEP164 pAb (ATL-HPA037606) at Atlas Antibodies

Documents & Links for Anti CEP164 pAb (ATL-HPA037606)
Datasheet Anti CEP164 pAb (ATL-HPA037606) Datasheet (External Link)
Vendor Page Anti CEP164 pAb (ATL-HPA037606)
Citations for Anti CEP164 pAb (ATL-HPA037606) – 11 Found
Alby, Caroline; Piquand, Kevin; Huber, Céline; Megarbané, André; Ichkou, Amale; Legendre, Marine; Pelluard, Fanny; Encha-Ravazi, Ferechté; Abi-Tayeh, Georges; Bessières, Bettina; El Chehadeh-Djebbar, Salima; Laurent, Nicole; Faivre, Laurence; Sztriha, László; Zombor, Melinda; Szabó, Hajnalka; Failler, Marion; Garfa-Traore, Meriem; Bole, Christine; Nitschké, Patrick; Nizon, Mathilde; Elkhartoufi, Nadia; Clerget-Darpoux, Françoise; Munnich, Arnold; Lyonnet, Stanislas; Vekemans, Michel; Saunier, Sophie; Cormier-Daire, Valérie; Attié-Bitach, Tania; Thomas, Sophie. Mutations in KIAA0586 Cause Lethal Ciliopathies Ranging from a Hydrolethalus Phenotype to Short-Rib Polydactyly Syndrome. American Journal Of Human Genetics. 2015;97(2):311-8.  PubMed
Schou, Kenneth B; Mogensen, Johanne B; Morthorst, Stine K; Nielsen, Brian S; Aleliunaite, Aiste; Serra-Marques, Andrea; Fürstenberg, Nicoline; Saunier, Sophie; Bizet, Albane A; Veland, Iben R; Akhmanova, Anna; Christensen, Søren T; Pedersen, Lotte B. KIF13B establishes a CAV1-enriched microdomain at the ciliary transition zone to promote Sonic hedgehog signalling. Nature Communications. 2017;8( 28134340):14177.  PubMed
Gonçalves, André Brás; Hasselbalch, Sarah Kirstine; Joensen, Beinta Biskopstø; Patzke, Sebastian; Martens, Pernille; Ohlsen, Signe Krogh; Quinodoz, Mathieu; Nikopoulos, Konstantinos; Suleiman, Reem; Damsø Jeppesen, Magnus Per; Weiss, Catja; Christensen, Søren Tvorup; Rivolta, Carlo; Andersen, Jens S; Farinelli, Pietro; Pedersen, Lotte Bang. CEP78 functions downstream of CEP350 to control biogenesis of primary cilia by negatively regulating CP110 levels. Elife. 2021;10( 34259627)  PubMed
Failler, Marion; Gee, Heon Yung; Krug, Pauline; Joo, Kwangsic; Halbritter, Jan; Belkacem, Lilya; Filhol, Emilie; Porath, Jonathan D; Braun, Daniela A; Schueler, Markus; Frigo, Amandine; Alibeu, Olivier; Masson, Cécile; Brochard, Karine; Hurault de Ligny, Bruno; Novo, Robert; Pietrement, Christine; Kayserili, Hulya; Salomon, Rémi; Gubler, Marie-Claire; Otto, Edgar A; Antignac, Corinne; Kim, Joon; Benmerah, Alexandre; Hildebrandt, Friedhelm; Saunier, Sophie. Mutations of CEP83 cause infantile nephronophthisis and intellectual disability. American Journal Of Human Genetics. 2014;94(6):905-14.  PubMed
Schueler, Markus; Braun, Daniela A; Chandrasekar, Gayathri; Gee, Heon Yung; Klasson, Timothy D; Halbritter, Jan; Bieder, Andrea; Porath, Jonathan D; Airik, Rannar; Zhou, Weibin; LoTurco, Joseph J; Che, Alicia; Otto, Edgar A; Böckenhauer, Detlef; Sebire, Neil J; Honzik, Tomas; Harris, Peter C; Koon, Sarah J; Gunay-Aygun, Meral; Saunier, Sophie; Zerres, Klaus; Bruechle, Nadina Ortiz; Drenth, Joost P H; Pelletier, Laurence; Tapia-Páez, Isabel; Lifton, Richard P; Giles, Rachel H; Kere, Juha; Hildebrandt, Friedhelm. DCDC2 mutations cause a renal-hepatic ciliopathy by disrupting Wnt signaling. American Journal Of Human Genetics. 2015;96(1):81-92.  PubMed
Ogungbenro, Yetunde Adesanya; Tena, Teresa Casar; Gaboriau, David; Lalor, Pierce; Dockery, Peter; Philipp, Melanie; Morrison, Ciaran G. Centrobin controls primary ciliogenesis in vertebrates. The Journal Of Cell Biology. 2018;217(4):1205-1215.  PubMed
Fang, Chieh-Ting; Kuo, Hsiao-Hui; Hsu, Shao-Chun; Yih, Ling-Huei. HSP70 is required for the proper assembly of pericentriolar material and function of mitotic centrosomes. Cell Division. 14( 31110557):4.  PubMed
So, Chun; Seres, K Bianka; Steyer, Anna M; Mönnich, Eike; Clift, Dean; Pejkovska, Anastasija; Möbius, Wiebke; Schuh, Melina. A liquid-like spindle domain promotes acentrosomal spindle assembly in mammalian oocytes. Science (New York, N.y.). 2019;364(6447)  PubMed
Shao, Wei; Yang, Jiajun; He, Ming; Yu, Xiang-Yu; Lee, Choong Heon; Yang, Zhaohui; Joyner, Alexandra L; Anderson, Kathryn V; Zhang, Jiangyang; Tsou, Meng-Fu Bryan; Shi, Hang; Shi, Song-Hai. Centrosome anchoring regulates progenitor properties and cortical formation. Nature. 2020;580(7801):106-112.  PubMed
Ryu, Hyunchul; Lee, Haeryung; Lee, Jiyeon; Noh, Hyuna; Shin, Miram; Kumar, Vijay; Hong, Sejeong; Kim, Jaebong; Park, Soochul. The molecular dynamics of subdistal appendages in multi-ciliated cells. Nature Communications. 2021;12(1):612.  PubMed
Frikstad, Kari-Anne M; Schink, Kay O; Gilani, Sania; Pedersen, Lotte B; Patzke, Sebastian. 3D-Structured Illumination Microscopy of Centrosomes in Human Cell Lines. Bio-Protocol. 2022;12(6):e4360.  PubMed