Anti CEP162 pAb (ATL-HPA030172)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030172-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CEP162
Alternative Gene Name: C6orf84, KIAA1009, QN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056919: 79%, ENSRNOG00000010608: 80%
Entrez Gene ID: 22832
Uniprot ID: Q5TB80
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LEKELDDIKEAHQITVRNLEAEIDVLKHQNAELDVKKNDKDDEDFQSIEFQVEQAHAKAKLVRLNEELAAKKREIQDLSKTVERLQKDRRMMLSNQNSKG |
| Gene Sequence | LEKELDDIKEAHQITVRNLEAEIDVLKHQNAELDVKKNDKDDEDFQSIEFQVEQAHAKAKLVRLNEELAAKKREIQDLSKTVERLQKDRRMMLSNQNSKG |
| Gene ID - Mouse | ENSMUSG00000056919 |
| Gene ID - Rat | ENSRNOG00000010608 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEP162 pAb (ATL-HPA030172) | |
| Datasheet | Anti CEP162 pAb (ATL-HPA030172) Datasheet (External Link) |
| Vendor Page | Anti CEP162 pAb (ATL-HPA030172) at Atlas Antibodies |
| Documents & Links for Anti CEP162 pAb (ATL-HPA030172) | |
| Datasheet | Anti CEP162 pAb (ATL-HPA030172) Datasheet (External Link) |
| Vendor Page | Anti CEP162 pAb (ATL-HPA030172) |