Anti CEP162 pAb (ATL-HPA030170)

Atlas Antibodies

Catalog No.:
ATL-HPA030170-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 162kDa
Gene Name: CEP162
Alternative Gene Name: C6orf84, KIAA1009, QN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056919: 58%, ENSRNOG00000010608: 56%
Entrez Gene ID: 22832
Uniprot ID: Q5TB80
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLLDSLDSVAEVNLDEQDKITPKPRCLPEMTENEMTGTGVSYGQSSSDVEALHQAYCHIAHSLGDEDKQKIESNTVEDIKSSVKGHPQEN
Gene Sequence VLLDSLDSVAEVNLDEQDKITPKPRCLPEMTENEMTGTGVSYGQSSSDVEALHQAYCHIAHSLGDEDKQKIESNTVEDIKSSVKGHPQEN
Gene ID - Mouse ENSMUSG00000056919
Gene ID - Rat ENSRNOG00000010608
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP162 pAb (ATL-HPA030170)
Datasheet Anti CEP162 pAb (ATL-HPA030170) Datasheet (External Link)
Vendor Page Anti CEP162 pAb (ATL-HPA030170) at Atlas Antibodies

Documents & Links for Anti CEP162 pAb (ATL-HPA030170)
Datasheet Anti CEP162 pAb (ATL-HPA030170) Datasheet (External Link)
Vendor Page Anti CEP162 pAb (ATL-HPA030170)
Citations for Anti CEP162 pAb (ATL-HPA030170) – 4 Found
Srivastava, Shalabh; Ramsbottom, Simon A; Molinari, Elisa; Alkanderi, Sumaya; Filby, Andrew; White, Kathryn; Henry, Charline; Saunier, Sophie; Miles, Colin G; Sayer, John A. A human patient-derived cellular model of Joubert syndrome reveals ciliary defects which can be rescued with targeted therapies. Human Molecular Genetics. 2017;26(23):4657-4667.  PubMed
Weng, Rueyhung Roc; Yang, T Tony; Huang, Chia-En; Chang, Chih-Wei; Wang, Won-Jing; Liao, Jung-Chi. Super-Resolution Imaging Reveals TCTN2 Depletion-Induced IFT88 Lumen Leakage and Ciliary Weakening. Biophysical Journal. 2018;115(2):263-275.  PubMed
Wang, Won-Jing; Tay, Hwee Goon; Soni, Rajesh; Perumal, Geoffrey S; Goll, Mary G; Macaluso, Frank P; Asara, John M; Amack, Jeffrey D; Tsou, Meng-Fu Bryan. CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base. Nature Cell Biology. 2013;15(6):591-601.  PubMed
Hall, Emma A; Kumar, Dhivya; Prosser, Suzanna L; Yeyati, Patricia L; Herranz-Pérez, Vicente; García-Verdugo, Jose Manuel; Rose, Lorraine; McKie, Lisa; Dodd, Daniel O; Tennant, Peter A; Megaw, Roly; Murphy, Laura C; Ferreira, Marisa F; Grimes, Graeme; Williams, Lucy; Quidwai, Tooba; Pelletier, Laurence; Reiter, Jeremy F; Mill, Pleasantine. Centriolar satellites expedite mother centriole remodeling to promote ciliogenesis. Elife. 2023;12( 36790165)  PubMed