Anti CEP152 pAb (ATL-HPA039408)

Atlas Antibodies

SKU: ATL-HPA039408-25

• 
• 

Protein Description: centrosomal protein 152kDa
Gene Name: CEP152
Alternative Gene Name: KIAA0912, MCPH4, SCKL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068394: 63%, ENSRNOG00000002394: 28%
Entrez Gene ID: 22995
Uniprot ID: O94986
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGELNIELTESYVDLGIKKVNWKKSKVTSIVQEEDPNEELSKDEFILKLKAEVQRLLGSNSMKRHLVSQLQNDLKDCHKKIEDLHQVKKDEKSIEVETKTDTSE
• Gene Sequence: EGELNIELTESYVDLGIKKVNWKKSKVTSIVQEEDPNEELSKDEFILKLKAEVQRLLGSNSMKRHLVSQLQNDLKDCHKKIEDLHQVKKDEKSIEVETKTDTSE
• Gene ID - Mouse: ENSMUSG00000068394
• Gene ID - Rat: ENSRNOG00000002394
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CEP152 pAb (ATL-HPA039408) – 4 Found

Olivier, Nicolas; Keller, Debora; Rajan, Vinoth Sundar; Gönczy, Pierre; Manley, Suliana. Simple buffers for 3D STORM microscopy. Biomedical Optics Express. 2013;4(6):885-99. 

Olivier, Nicolas; Keller, Debora; Gönczy, Pierre; Manley, Suliana. Resolution doubling in 3D-STORM imaging through improved buffers. Plos One. 8(7):e69004. 

Keller, Debora; Orpinell, Meritxell; Olivier, Nicolas; Wachsmuth, Malte; Mahen, Robert; Wyss, Romain; Hachet, Virginie; Ellenberg, Jan; Manley, Suliana; Gönczy, Pierre. Mechanisms of HsSAS-6 assembly promoting centriole formation in human cells. The Journal Of Cell Biology. 2014;204(5):697-712. 

Balestra, Fernando R; Domínguez-Calvo, Andrés; Wolf, Benita; Busso, Coralie; Buff, Alizée; Averink, Tessa; Lipsanen-Nyman, Marita; Huertas, Pablo; Ríos, Rosa M; Gönczy, Pierre. TRIM37 prevents formation of centriolar protein assemblies by regulating Centrobin. Elife. 2021;10( 33491649)