Anti CEP152 pAb (ATL-HPA039408)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039408-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CEP152
Alternative Gene Name: KIAA0912, MCPH4, SCKL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068394: 63%, ENSRNOG00000002394: 28%
Entrez Gene ID: 22995
Uniprot ID: O94986
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EGELNIELTESYVDLGIKKVNWKKSKVTSIVQEEDPNEELSKDEFILKLKAEVQRLLGSNSMKRHLVSQLQNDLKDCHKKIEDLHQVKKDEKSIEVETKTDTSE |
| Gene Sequence | EGELNIELTESYVDLGIKKVNWKKSKVTSIVQEEDPNEELSKDEFILKLKAEVQRLLGSNSMKRHLVSQLQNDLKDCHKKIEDLHQVKKDEKSIEVETKTDTSE |
| Gene ID - Mouse | ENSMUSG00000068394 |
| Gene ID - Rat | ENSRNOG00000002394 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEP152 pAb (ATL-HPA039408) | |
| Datasheet | Anti CEP152 pAb (ATL-HPA039408) Datasheet (External Link) |
| Vendor Page | Anti CEP152 pAb (ATL-HPA039408) at Atlas Antibodies |
| Documents & Links for Anti CEP152 pAb (ATL-HPA039408) | |
| Datasheet | Anti CEP152 pAb (ATL-HPA039408) Datasheet (External Link) |
| Vendor Page | Anti CEP152 pAb (ATL-HPA039408) |
| Citations for Anti CEP152 pAb (ATL-HPA039408) – 4 Found |
| Olivier, Nicolas; Keller, Debora; Rajan, Vinoth Sundar; Gönczy, Pierre; Manley, Suliana. Simple buffers for 3D STORM microscopy. Biomedical Optics Express. 2013;4(6):885-99. PubMed |
| Olivier, Nicolas; Keller, Debora; Gönczy, Pierre; Manley, Suliana. Resolution doubling in 3D-STORM imaging through improved buffers. Plos One. 8(7):e69004. PubMed |
| Keller, Debora; Orpinell, Meritxell; Olivier, Nicolas; Wachsmuth, Malte; Mahen, Robert; Wyss, Romain; Hachet, Virginie; Ellenberg, Jan; Manley, Suliana; Gönczy, Pierre. Mechanisms of HsSAS-6 assembly promoting centriole formation in human cells. The Journal Of Cell Biology. 2014;204(5):697-712. PubMed |
| Balestra, Fernando R; Domínguez-Calvo, Andrés; Wolf, Benita; Busso, Coralie; Buff, Alizée; Averink, Tessa; Lipsanen-Nyman, Marita; Huertas, Pablo; Ríos, Rosa M; Gönczy, Pierre. TRIM37 prevents formation of centriolar protein assemblies by regulating Centrobin. Elife. 2021;10( 33491649) PubMed |