Anti CEP152 pAb (ATL-HPA039408)

Atlas Antibodies

Catalog No.:
ATL-HPA039408-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 152kDa
Gene Name: CEP152
Alternative Gene Name: KIAA0912, MCPH4, SCKL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068394: 63%, ENSRNOG00000002394: 28%
Entrez Gene ID: 22995
Uniprot ID: O94986
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGELNIELTESYVDLGIKKVNWKKSKVTSIVQEEDPNEELSKDEFILKLKAEVQRLLGSNSMKRHLVSQLQNDLKDCHKKIEDLHQVKKDEKSIEVETKTDTSE
Gene Sequence EGELNIELTESYVDLGIKKVNWKKSKVTSIVQEEDPNEELSKDEFILKLKAEVQRLLGSNSMKRHLVSQLQNDLKDCHKKIEDLHQVKKDEKSIEVETKTDTSE
Gene ID - Mouse ENSMUSG00000068394
Gene ID - Rat ENSRNOG00000002394
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP152 pAb (ATL-HPA039408)
Datasheet Anti CEP152 pAb (ATL-HPA039408) Datasheet (External Link)
Vendor Page Anti CEP152 pAb (ATL-HPA039408) at Atlas Antibodies

Documents & Links for Anti CEP152 pAb (ATL-HPA039408)
Datasheet Anti CEP152 pAb (ATL-HPA039408) Datasheet (External Link)
Vendor Page Anti CEP152 pAb (ATL-HPA039408)
Citations for Anti CEP152 pAb (ATL-HPA039408) – 4 Found
Olivier, Nicolas; Keller, Debora; Rajan, Vinoth Sundar; Gönczy, Pierre; Manley, Suliana. Simple buffers for 3D STORM microscopy. Biomedical Optics Express. 2013;4(6):885-99.  PubMed
Olivier, Nicolas; Keller, Debora; Gönczy, Pierre; Manley, Suliana. Resolution doubling in 3D-STORM imaging through improved buffers. Plos One. 8(7):e69004.  PubMed
Keller, Debora; Orpinell, Meritxell; Olivier, Nicolas; Wachsmuth, Malte; Mahen, Robert; Wyss, Romain; Hachet, Virginie; Ellenberg, Jan; Manley, Suliana; Gönczy, Pierre. Mechanisms of HsSAS-6 assembly promoting centriole formation in human cells. The Journal Of Cell Biology. 2014;204(5):697-712.  PubMed
Balestra, Fernando R; Domínguez-Calvo, Andrés; Wolf, Benita; Busso, Coralie; Buff, Alizée; Averink, Tessa; Lipsanen-Nyman, Marita; Huertas, Pablo; Ríos, Rosa M; Gönczy, Pierre. TRIM37 prevents formation of centriolar protein assemblies by regulating Centrobin. Elife. 2021;10( 33491649)  PubMed