Anti CEP131 pAb (ATL-HPA024019)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024019-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CEP131
Alternative Gene Name: AZ1, AZI1, KIAA1118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039781: 76%, ENSRNOG00000004430: 75%
Entrez Gene ID: 22994
Uniprot ID: Q9UPN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DFLMLFEGSPSGKKRPASLSTAPSEKGATWNVLDDQPRGFTLPSNARSSSALDSPAGPRRKECTVALAPNFTANNRSNKGAVGNCVTTM |
| Gene Sequence | DFLMLFEGSPSGKKRPASLSTAPSEKGATWNVLDDQPRGFTLPSNARSSSALDSPAGPRRKECTVALAPNFTANNRSNKGAVGNCVTTM |
| Gene ID - Mouse | ENSMUSG00000039781 |
| Gene ID - Rat | ENSRNOG00000004430 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEP131 pAb (ATL-HPA024019) | |
| Datasheet | Anti CEP131 pAb (ATL-HPA024019) Datasheet (External Link) |
| Vendor Page | Anti CEP131 pAb (ATL-HPA024019) at Atlas Antibodies |
| Documents & Links for Anti CEP131 pAb (ATL-HPA024019) | |
| Datasheet | Anti CEP131 pAb (ATL-HPA024019) Datasheet (External Link) |
| Vendor Page | Anti CEP131 pAb (ATL-HPA024019) |
| Citations for Anti CEP131 pAb (ATL-HPA024019) – 1 Found |
| Chamling, Xitiz; Seo, Seongjin; Searby, Charles C; Kim, Gunhee; Slusarski, Diane C; Sheffield, Val C. The centriolar satellite protein AZI1 interacts with BBS4 and regulates ciliary trafficking of the BBSome. Plos Genetics. 2014;10(2):e1004083. PubMed |