Anti CEP131 pAb (ATL-HPA024019)

Atlas Antibodies

Catalog No.:
ATL-HPA024019-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 131kDa
Gene Name: CEP131
Alternative Gene Name: AZ1, AZI1, KIAA1118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039781: 76%, ENSRNOG00000004430: 75%
Entrez Gene ID: 22994
Uniprot ID: Q9UPN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DFLMLFEGSPSGKKRPASLSTAPSEKGATWNVLDDQPRGFTLPSNARSSSALDSPAGPRRKECTVALAPNFTANNRSNKGAVGNCVTTM
Gene Sequence DFLMLFEGSPSGKKRPASLSTAPSEKGATWNVLDDQPRGFTLPSNARSSSALDSPAGPRRKECTVALAPNFTANNRSNKGAVGNCVTTM
Gene ID - Mouse ENSMUSG00000039781
Gene ID - Rat ENSRNOG00000004430
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEP131 pAb (ATL-HPA024019)
Datasheet Anti CEP131 pAb (ATL-HPA024019) Datasheet (External Link)
Vendor Page Anti CEP131 pAb (ATL-HPA024019) at Atlas Antibodies

Documents & Links for Anti CEP131 pAb (ATL-HPA024019)
Datasheet Anti CEP131 pAb (ATL-HPA024019) Datasheet (External Link)
Vendor Page Anti CEP131 pAb (ATL-HPA024019)
Citations for Anti CEP131 pAb (ATL-HPA024019) – 1 Found
Chamling, Xitiz; Seo, Seongjin; Searby, Charles C; Kim, Gunhee; Slusarski, Diane C; Sheffield, Val C. The centriolar satellite protein AZI1 interacts with BBS4 and regulates ciliary trafficking of the BBSome. Plos Genetics. 2014;10(2):e1004083.  PubMed