Anti CEP131 pAb (ATL-HPA024019)

Atlas Antibodies

SKU: ATL-HPA024019-25

• 
• 
• 

Protein Description: centrosomal protein 131kDa
Gene Name: CEP131
Alternative Gene Name: AZ1, AZI1, KIAA1118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039781: 76%, ENSRNOG00000004430: 75%
Entrez Gene ID: 22994
Uniprot ID: Q9UPN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DFLMLFEGSPSGKKRPASLSTAPSEKGATWNVLDDQPRGFTLPSNARSSSALDSPAGPRRKECTVALAPNFTANNRSNKGAVGNCVTTM
• Gene Sequence: DFLMLFEGSPSGKKRPASLSTAPSEKGATWNVLDDQPRGFTLPSNARSSSALDSPAGPRRKECTVALAPNFTANNRSNKGAVGNCVTTM
• Gene ID - Mouse: ENSMUSG00000039781
• Gene ID - Rat: ENSRNOG00000004430
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CEP131 pAb (ATL-HPA024019) – 1 Found

Chamling, Xitiz; Seo, Seongjin; Searby, Charles C; Kim, Gunhee; Slusarski, Diane C; Sheffield, Val C. The centriolar satellite protein AZI1 interacts with BBS4 and regulates ciliary trafficking of the BBSome. Plos Genetics. 2014;10(2):e1004083.