Anti CEP112 pAb (ATL-HPA024481)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024481-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CEP112
Alternative Gene Name: CCDC46, MGC33887
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020728: 82%, ENSRNOG00000024557: 77%
Entrez Gene ID: 201134
Uniprot ID: Q8N8E3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RNTLHKEKDHLVNDYEQNMKLLQTKYDADINLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQE |
Gene Sequence | RNTLHKEKDHLVNDYEQNMKLLQTKYDADINLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQE |
Gene ID - Mouse | ENSMUSG00000020728 |
Gene ID - Rat | ENSRNOG00000024557 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEP112 pAb (ATL-HPA024481) | |
Datasheet | Anti CEP112 pAb (ATL-HPA024481) Datasheet (External Link) |
Vendor Page | Anti CEP112 pAb (ATL-HPA024481) at Atlas Antibodies |
Documents & Links for Anti CEP112 pAb (ATL-HPA024481) | |
Datasheet | Anti CEP112 pAb (ATL-HPA024481) Datasheet (External Link) |
Vendor Page | Anti CEP112 pAb (ATL-HPA024481) |
Citations for Anti CEP112 pAb (ATL-HPA024481) – 1 Found |
Jakobsen, Lis; Vanselow, Katja; Skogs, Marie; Toyoda, Yusuke; Lundberg, Emma; Poser, Ina; Falkenby, Lasse G; Bennetzen, Martin; Westendorf, Jens; Nigg, Erich A; Uhlen, Mathias; Hyman, Anthony A; Andersen, Jens S. Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods. The Embo Journal. 2011;30(8):1520-35. PubMed |