Anti CEP112 pAb (ATL-HPA024481)

Atlas Antibodies

Catalog No.: ATL-HPA024481-25

Protein Description: centrosomal protein 112kDa
Gene Name: CEP112
Alternative Gene Name: CCDC46, MGC33887
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020728: 82%, ENSRNOG00000024557: 77%
Entrez Gene ID: 201134
Uniprot ID: Q8N8E3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RNTLHKEKDHLVNDYEQNMKLLQTKYDADINLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQE
• Gene Sequence: RNTLHKEKDHLVNDYEQNMKLLQTKYDADINLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQE
• Gene ID - Mouse: ENSMUSG00000020728
• Gene ID - Rat: ENSRNOG00000024557
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CEP112 pAb (ATL-HPA024481) – 1 Found

Jakobsen, Lis; Vanselow, Katja; Skogs, Marie; Toyoda, Yusuke; Lundberg, Emma; Poser, Ina; Falkenby, Lasse G; Bennetzen, Martin; Westendorf, Jens; Nigg, Erich A; Uhlen, Mathias; Hyman, Anthony A; Andersen, Jens S. Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods. The Embo Journal. 2011;30(8):1520-35.