Anti CENPW pAb (ATL-HPA067285)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067285-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CENPW
Alternative Gene Name: C6orf173, CUG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075266: 59%, ENSRNOG00000042944: 62%
Entrez Gene ID: 387103
Uniprot ID: Q5EE01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEK |
| Gene Sequence | MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEK |
| Gene ID - Mouse | ENSMUSG00000075266 |
| Gene ID - Rat | ENSRNOG00000042944 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CENPW pAb (ATL-HPA067285) | |
| Datasheet | Anti CENPW pAb (ATL-HPA067285) Datasheet (External Link) |
| Vendor Page | Anti CENPW pAb (ATL-HPA067285) at Atlas Antibodies |
| Documents & Links for Anti CENPW pAb (ATL-HPA067285) | |
| Datasheet | Anti CENPW pAb (ATL-HPA067285) Datasheet (External Link) |
| Vendor Page | Anti CENPW pAb (ATL-HPA067285) |